DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St3gal2

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_033205.2 Gene:St3gal2 / 20444 MGIID:99427 Length:350 Species:Mus musculus


Alignment Length:204 Identity:54/204 - (26%)
Similarity:86/204 - (42%) Gaps:56/204 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 FRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVV--NSQVV 294
            ||:.:..:.||:|.::|:|.||..|:.:|:|:.:||.|.|||.|.|.||||:||...:  .|...
Mouse   143 FRDPQQCRRCAVVGNSGNLRGSGYGQEVDSHNFIMRMNQAPTVGFEKDVGSRTTHHFMYPESAKN 207

  Fly   295 TKPEFDFTRAPIFRNVTIAAWDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAFL-IDPHS 358
            ......|...| |:.:.:.             |:.||    .|..:: |..|...::|| :|...
Mouse   208 LPANVSFVLVP-FKALDLM-------------WIASA----LSTGQI-RFTYAPVKSFLRVDKEK 253

  Fly   359 VWRLWQSLQMFAGNRPISKNP-----------------PSSGFIGLALLLPHCPQVDFVEYVPST 406
            |       |::        ||                 ||:|.:.|...|..|.:|:...:...:
Mouse   254 V-------QIY--------NPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADS 303

  Fly   407 RLNGRCHYY 415
            |  |..|:|
Mouse   304 R--GNWHHY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 54/204 (26%)
St3gal2NP_033205.2 Glyco_transf_29 94..348 CDD:395627 54/204 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.