DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St3gal4

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_006510171.1 Gene:St3gal4 / 20443 MGIID:1316743 Length:373 Species:Mus musculus


Alignment Length:294 Identity:68/294 - (23%)
Similarity:116/294 - (39%) Gaps:78/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 VFGDSFEEQ--------YY----PSTCLVMEAGVRVLRRKDAPFNKLPFGRLFPRQKLFR----- 233
            :||:...||        |:    |||                  .:||||.......|.|     
Mouse    98 IFGNRSREQPIFLQLKDYFWVKTPST------------------YELPFGTKGSEDLLLRVLAIT 144

  Fly   234 ------NVKDI--KTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVN 290
                  ::|.:  :.|.:|.:...|..|.||..|:.:|:|:|.|:||..|:|.|||||||||:..
Mouse   145 SYSIPESIKSLECRRCVVVGNGHRLRNSSLGGVINKYDVVIRLNNAPVAGYEGDVGSKTTIRLFY 209

  Fly   291 SQVVTKPEFDFTRAPIFRN-----VTIAAWDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKSR 350
            .:   ...||    |...|     :.:.|:....::     |:.:    :.|:.:..|:.:.|..
Mouse   210 PE---SAHFD----PKIENNPDTLLVLVAFKAMDFH-----WIET----ILSDKKRVRKGFWKQP 258

  Fly   351 AFL--IDPHSVWRLWQSLQMFAGNRPIS---------KNPPSSGFIGLALLLPHCPQVDFV--EY 402
            ..:  ::|..|..|.......|.::.:|         |..|::|.:.:.|.|..|..|...  .|
Mouse   259 PLIWDVNPKQVRILNPFFMEIAADKLLSLPIQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGY 323

  Fly   403 VPSTRLNGRCHYYSKEMNSACTFGSWHPLAAEKL 436
            ..::......||| :::......||.|.::.|.:
Mouse   324 PDASNKKQTIHYY-EQITLKSMAGSGHNVSQEAI 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 56/244 (23%)
St3gal4XP_006510171.1 Glyco_transf_29 147..371 CDD:366297 54/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.