DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St3gal3

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_006502953.1 Gene:St3gal3 / 20441 MGIID:1316659 Length:424 Species:Mus musculus


Alignment Length:252 Identity:64/252 - (25%)
Similarity:92/252 - (36%) Gaps:80/252 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 KTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQ-VVTKPEFDFT 302
            :.|.||.:.|.||...||..||.:|||:|.|.||.:|.|.|||||||:|:...: .:.:|| .:.
Mouse   179 RRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFERDVGSKTTLRITYPEGAMQRPE-QYE 242

  Fly   303 RAPIFRNVTIAA--WDPGKYNGTLEDWLTSADYDLFSNYELYRRRYP-----KSRAFLIDPHSVW 360
            |..:|   .:|.  |...|       ||         .|.:|:.|.|     |.|...:......
Mouse   243 RDSLF---VLAGFKWQDFK-------WL---------KYIVYKERVPFPSKAKCRQCQVGSEQER 288

  Fly   361 R-------------LWQSLQMFAGNRP----------ISK------------------NPPSSGF 384
            |             .|:|:.......|          |.:                  |.|:.|.
Mouse   289 RQKSGPDAQSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGS 353

  Fly   385 IGLALLLPHCPQVDFVEY-----VPSTRLNGRCHYYSKEMNSACTFGSW-HPLAAEK 435
            :.:.:.|..|.:|....:     .|    |...||| :.:..|....|| |.:..||
Mouse   354 VAVTMALHGCDEVAVAGFGYDMNTP----NAPLHYY-ETVRMAAIKESWTHNIQREK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 64/252 (25%)
St3gal3XP_006502953.1 Glyco_transf_29 128..420 CDD:366297 64/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.