DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St8sia4

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_446366.1 Gene:St8sia4 / 116696 RGDID:621845 Length:454 Species:Rattus norvegicus


Alignment Length:428 Identity:97/428 - (22%)
Similarity:159/428 - (37%) Gaps:83/428 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AQPGREPGEVNSRQPGNGAYEN-STGTERRLRKVIWKCIPTGNGTTGHRVPRSVFHVRWNPNEKF 102
            ||....|...|.......|.|| .:.|..|...:|          .|.|:.....:.|:.|.:.|
  Rat    17 AQSDPSPASANCAAGRWAALENRESSTAERPSDLI----------LGSRLHAPFANFRFLPLDYF 71

  Fly   103 ----IVESRENPAINSSKLAPHPRLKVSKNTKLTLSPKLYLCHDKHSELCHNKTQQFRQRIVRAF 163
                .:...:.|.:....|:..|:::..:......:..|.|...|..|:...:..|..| ::...
  Rat    72 PKTEPLYQEKVPELGQPGLSRAPKMRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQ-LIGDG 135

  Fly   164 EKAMVES-VNESQANHYNVDYK---PVFGDSFEEQYYPSTCLVMEAGVRVLRRKDA--------- 215
            |..:..| ||.|.    .:..|   .:|..|. :.:..::.||:|....:||..||         
  Rat   136 ELCLSRSLVNNSD----KITRKAGSTIFQHSV-QGWKINSSLVLEIRKNILRFLDAERDVSVVKS 195

  Fly   216 ---PFNKLPF--------------GRLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHD 263
               |.:.:.:              ..|.|.....:| :..||||:|.::|.|..|..|:.||:|:
  Rat   196 SFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKN-RRFKTCAVVGNSGILLDSGCGKEIDSHN 259

  Fly   264 IVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKP------EFD---FTRAPIFRNVTIAAWDPG- 318
            .|:|.|.||......|||:|:....:|..||.:.      |.|   |.......|.:: .|.|. 
  Rat   260 FVIRCNLAPVVEFAADVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSV-LWIPAF 323

  Fly   319 --KYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRPISKNPPS 381
              |......:|:.:.   :..|....|..||..|..    |:|...|.:.::     ||.:  ||
  Rat   324 MVKGGEKHVEWVNAL---ILKNKLKVRTAYPSLRLI----HAVRGYWLTNKV-----PIKR--PS 374

  Fly   382 SGFIGLALLLPHCPQVDFVEYVPSTR-LNGRC---HYY 415
            :|.:...|....|.::....:.|..: |||:.   |||
  Rat   375 TGLLMYTLATRFCDEIHLYGFWPFPKDLNGKAVKYHYY 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 57/208 (27%)
St8sia4NP_446366.1 Glyco_transf_29 189..448 CDD:279159 58/240 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.