DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st3gal5

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001165301.1 Gene:st3gal5 / 100329191 XenbaseID:XB-GENE-955106 Length:372 Species:Xenopus tropicalis


Alignment Length:346 Identity:75/346 - (21%)
Similarity:126/346 - (36%) Gaps:84/346 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 HDKHSELCHNKTQQFRQRIVRAFEKAMVESVNESQANHYNVDYKPVFGDSFEEQYYPSTCLVMEA 205
            |.::|........|...|:.||  |.....|.::|.       :|.|..:..::.:.|.   ...
 Frog    33 HGRNSAQAKGSLIQSHIRMYRA--KTFARDVLQAQC-------RPAFARTQMDRLFSSK---YTK 85

  Fly   206 GVRVLRRKDAPFNKL------PFG------------RLFPRQKLFRNV--KDIKTCAIVSSAGSL 250
            .:....:||...|:.      |||            .:.|...|.:.:  |..|.|.::.|.|.|
 Frog    86 NLSSFIKKDKSLNESLYKYEPPFGFRHYVDELSDLLEMMPEDGLPKELHSKHCKRCIVIGSGGIL 150

  Fly   251 AGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPEFDFTRAPIF-------- 307
            .|.:||:.:|..|||:|.|:||..|:..|||:|||||:...:.....|.::..:.:|        
 Frog   151 HGLELGQMVDQFDIVIRLNNAPVHGYAQDVGNKTTIRMTYPEGAPVSEQEYQHSSLFVTVLFKHA 215

  Fly   308 ---------RNVTIAAWDPGKYNGTLEDW--LTSADYDLFSNYELYRRR-----YPKSRAFLIDP 356
                     :|..::||:...:...:.|.  |.|:.:.:.:...:....     :||       |
 Frog   216 DFRWLEAVLKNQKLSAWNRFFFWKRVTDKIPLNSSQFRVLNPLIIKETAIDILGFPK-------P 273

  Fly   357 HSVWRLWQSLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDFVEY-----VPSTRLNGRCHYYS 416
            ...|..|            .||.|:.|...:.|....|.:|:...:     .|...|    |||.
 Frog   274 QKRWLGW------------DKNVPTIGMTAVILATHLCDEVNLAGFGYDLSQPDASL----HYYD 322

  Fly   417 KEMNSACTFGSWHPLAAEKLM 437
            ....::......|.:..||.|
 Frog   323 NRCMNSMNDQPMHDVTKEKKM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 56/243 (23%)
st3gal5NP_001165301.1 Glyco_transf_29 89..356 CDD:279159 63/278 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.