DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and Prg4

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_067375.3 Gene:Prg4 / 96875 MGIID:1891344 Length:1221 Species:Mus musculus


Alignment Length:270 Identity:70/270 - (25%)
Similarity:107/270 - (39%) Gaps:69/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 PKVPLDDSICKDSKVDTLFNSAQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAAF 355
            |.:..:.::|....||.|.....|...||:| .|:.:.........|:.|::.| |:|..||..|
Mouse   953 PMLSDETNLCNGKPVDGLTTLRNGTLVAFRG-HYFWMLNPFRPPSPPRRITEVW-GIPSPIDTVF 1015

  Fly   356 TYKN--GKTYFFKGTQYWRYQGRQMDGVYPKEISEGFTGIPDHLDAAM-----------VW---- 403
            |..|  |||:|||.:||||:....:|..|||:|.:||.|:...:.||:           |:    
Mouse  1016 TRCNCEGKTFFFKDSQYWRFTNDVVDPGYPKQIVKGFGGLTGKIVAALSIAKYKDRPESVYFFKR 1080

  Fly   404 GGNGKIYFFKGS-----------------------KFWRFDPAKRP------------PVKASYP 433
            |||.:.|.:|..                       :..||:.|..|            |::.||.
Mouse  1081 GGNIQQYTYKQEPMKKCTGRRPAINYSVYGEAAQVRRRRFERAVGPFQTHTFRIHYSVPMRVSYQ 1145

  Fly   434 ---------KPISNWEGVPNNLDAALKYTN-----GYTYF-FKGDKYYRFHDARFAVDSATPPFP 483
                     |..:.|.|.||.:.:|:...|     ||.|: |..|:||..........:.|....
Mouse  1146 DKGFLHNEVKVSTMWRGFPNVVTSAITLPNIRKPDGYDYYAFSKDQYYNIDVPTRTARAITTRSG 1210

  Fly   484 RPTAHWWFGC 493
            :..:..|:.|
Mouse  1211 QTLSKIWYNC 1220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773
Peptidase_M10 115..268 CDD:278824
ZnMc_MMP 115..268 CDD:239805
HX 298..493 CDD:238046 68/261 (26%)
Prg4NP_067375.3 SO 26..68 CDD:197571
SO 67..108 CDD:197571
PHA03247 <446..761 CDD:223021
PTZ00449 <634..938 CDD:185628
HX 959..1220 CDD:238046 68/262 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.