Sequence 1: | NP_726473.2 | Gene: | Mmp1 / 37949 | FlyBaseID: | FBgn0035049 | Length: | 584 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067375.3 | Gene: | Prg4 / 96875 | MGIID: | 1891344 | Length: | 1221 | Species: | Mus musculus |
Alignment Length: | 270 | Identity: | 70/270 - (25%) |
---|---|---|---|
Similarity: | 107/270 - (39%) | Gaps: | 69/270 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 291 PKVPLDDSICKDSKVDTLFNSAQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAAF 355
Fly 356 TYKN--GKTYFFKGTQYWRYQGRQMDGVYPKEISEGFTGIPDHLDAAM-----------VW---- 403
Fly 404 GGNGKIYFFKGS-----------------------KFWRFDPAKRP------------PVKASYP 433
Fly 434 ---------KPISNWEGVPNNLDAALKYTN-----GYTYF-FKGDKYYRFHDARFAVDSATPPFP 483
Fly 484 RPTAHWWFGC 493 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mmp1 | NP_726473.2 | PG_binding_1 | 32..88 | CDD:279773 | |
Peptidase_M10 | 115..268 | CDD:278824 | |||
ZnMc_MMP | 115..268 | CDD:239805 | |||
HX | 298..493 | CDD:238046 | 68/261 (26%) | ||
Prg4 | NP_067375.3 | SO | 26..68 | CDD:197571 | |
SO | 67..108 | CDD:197571 | |||
PHA03247 | <446..761 | CDD:223021 | |||
PTZ00449 | <634..938 | CDD:185628 | |||
HX | 959..1220 | CDD:238046 | 68/262 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1565 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |