DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and Mmp23

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_446058.1 Gene:Mmp23 / 94339 RGDID:620201 Length:391 Species:Rattus norvegicus


Alignment Length:299 Identity:88/299 - (29%)
Similarity:122/299 - (40%) Gaps:79/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SRSKRYALQGS--RWRVKNLTYKISKYPKR-LKRVDVDAEIGRAFAVWSEDTDLTFTR-KTSGPV 164
            :|.:||.|..:  ||...||||:|..:|:. |...:....:..||.:||:.:..:|.. ....|.
  Rat    75 TRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPEETRRGLAAAFRMWSDVSPFSFREVAPERPS 139

  Fly   165 HIEIKFVESEHGD------GDAFDGQGGTLAHAFFPVFGGDAHFDDAELWTIGSPRG-------- 215
            .::|.|....|.|      ...|||..|.|||||||..|| .||||:|.|.:|..|.        
  Rat   140 DLKIGFYPVNHTDCLVSALHHCFDGPTGELAHAFFPPHGG-IHFDDSEYWVLGPTRYSWKKGVWL 203

  Fly   216 TNLFQVAAHEFGHSLGLSHSDQSSALM--APFYRGFEPVFKLDEDDKAAIQSLYG---------- 268
            |:|..|||||.||:|||.||.|..|||  ....||::   .|.:|:...:..|||          
  Rat   204 TDLVHVAAHEIGHALGLMHSQQDQALMHLNATLRGWK---ALSQDELWGLHRLYGCLDRIFVCTS 265

  Fly   269 -----------RKTNQLRPTNV-------YP--ATTQRPYSPPKVPLDDSICKDSKVDTLFNSAQ 313
                       |...:|.|.:.       :|  |||..|               ::..|.| ..:
  Rat   266 WARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVATTTSP---------------TRTKTRF-VRE 314

  Fly   314 GETYAF---------KGDKYYKLTTDSVEEGYPQLISKG 343
            |....|         ||..|:....:.:|..||..::.|
  Rat   315 GRNMTFHCGQKILHKKGKVYWYKDQEPLEFSYPGYLALG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773
Peptidase_M10 115..268 CDD:278824 63/170 (37%)
ZnMc_MMP 115..268 CDD:239805 63/170 (37%)
HX 298..493 CDD:238046 11/55 (20%)
Mmp23NP_446058.1 Peptidase_M10 88..255 CDD:278824 63/170 (37%)
ZnMc_MMP 88..255 CDD:239805 63/170 (37%)
ShKT 256..290 CDD:214586 3/33 (9%)
Ig 314..376 CDD:299845 9/40 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.