DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and MMP23B

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:XP_016858104.1 Gene:MMP23B / 8510 HGNCID:7171 Length:526 Species:Homo sapiens


Alignment Length:325 Identity:91/325 - (28%)
Similarity:126/325 - (38%) Gaps:88/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGS--RWRVKNLTYKISKYPKR-LKRVDVDAEIG 142
            |...:.|.::|...|   .|....|.:||.|..:  ||...||||:|..:|:. |...:....:.
Human   190 DVAALGLSAVPPTRV---PGPLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALA 251

  Fly   143 RAFAVWSEDTDLTFTR-KTSGPVHIEIKFVESEHGD------GDAFDGQGGTLAHAFFPVFGGDA 200
            .||.:||:.:..:|.. ....|..:.|.|....|.|      ...|||..|.|||||||..|| .
Human   252 AAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGG-I 315

  Fly   201 HFDDAELWTIGSPRG--------TNLFQVAAHEFGHSLGLSHSDQSSALM--APFYRGFEPVFKL 255
            ||||:|.|.:|..|.        |:|..|||||.||:|||.||....|||  ....||::   .|
Human   316 HFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWK---AL 377

  Fly   256 DEDDKAAIQSLYG---------------------RKTNQLRPTNV-------YPATTQRPYSPPK 292
            .:|:...:..|||                     |...:|.|::.       :|.....| .||:
Human   378 SQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTP-PPPR 441

  Fly   293 -----VPLDDSICKDSKVDTLFNSAQGETYAF---------KGDKYYKLTTDSVEEGYPQLISKG 343
                 ||                  :|....|         ||..|:....:.:|..||..::.|
Human   442 TKTRLVP------------------EGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALG 488

  Fly   344  343
            Human   489  488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773 1/6 (17%)
Peptidase_M10 115..268 CDD:278824 62/170 (36%)
ZnMc_MMP 115..268 CDD:239805 62/170 (36%)
HX 298..493 CDD:238046 9/55 (16%)
MMP23BXP_016858104.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.