DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and MMP

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_177174.1 Gene:MMP / 843353 AraportID:AT1G70170 Length:378 Species:Arabidopsis thaliana


Alignment Length:282 Identity:101/282 - (35%)
Similarity:128/282 - (45%) Gaps:38/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YLSQFGYLPASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRV- 99
            |..:|||:|.:.....:....|  ...:|:|.:|:...||:||||||.|::.:.:||||..|.| 
plant    65 YFQRFGYIPETFSGNFTDDFDD--ILKAAVELYQTNFNLNVTGELDALTIQHIVIPRCGNPDVVN 127

  Fly   100 GT----GDSRS--------------KRYAL-QGS-RW--RVKNLTYKISKYPKRLKRVDVDAEIG 142
            ||    |..|.              |||.| .|. ||  ..::|||...  ||.....:|.:...
plant   128 GTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPRWPRNRRDLTYAFD--PKNPLTEEVKSVFS 190

  Fly   143 RAFAVWSEDTDLTFTRKTS-GPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDDAE 206
            |||..||:.|.|.||...| ....|.|.|...:||||:.|||..|||||||.|. .|..|.|..|
plant   191 RAFGRWSDVTALNFTLSESFSTSDITIGFYTGDHGDGEPFDGVLGTLAHAFSPP-SGKFHLDADE 254

  Fly   207 LWTIGS--------PRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGFEPVFKLDEDDKAAI 263
            .|.:..        ....:|..||.||.||.|||.||....::|.|.....:....|..||...|
plant   255 NWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGI 319

  Fly   264 QSLYGRKTNQLRPTNVYPATTQ 285
            |.|||...| ...|...|:||:
plant   320 QYLYGANPN-FNGTTSPPSTTK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773 18/51 (35%)
Peptidase_M10 115..268 CDD:278824 61/163 (37%)
ZnMc_MMP 115..268 CDD:239805 61/163 (37%)
HX 298..493 CDD:238046
MMPNP_177174.1 PG_binding_1 62..115 CDD:396175 18/51 (35%)
Peptidase_M10 163..324 CDD:395334 61/163 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I2423
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 1 1.000 - - FOG0000127
OrthoInspector 1 1.000 - - mtm995
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X44
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.