DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and AT1G59970

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_176205.1 Gene:AT1G59970 / 842291 AraportID:AT1G59970 Length:360 Species:Arabidopsis thaliana


Alignment Length:260 Identity:93/260 - (35%)
Similarity:123/260 - (47%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YLSQFGYLPASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRV- 99
            |..:|||:..:..  .:....|  ...|||..:|....|.:||:||:.|::.:..||||..|.: 
plant    66 YFRRFGYITTTGN--CTDDFDD--VLQSAINTYQKNFNLKVTGKLDSSTLRQIVKPRCGNPDLID 126

  Fly   100 GTGDSR-------SKRYA-LQGS-RW--RVKNLTYKISKYPKRLKRVDVDAEIGRAFAVWSEDTD 153
            |..:..       :::|: ..|. ||  |.::|||..:  |:.....:|.....|||..|:|.|.
plant   127 GVSEMNGGKILRTTEKYSFFPGKPRWPKRKRDLTYAFA--PQNNLTDEVKRVFSRAFTRWAEVTP 189

  Fly   154 LTFTRKTS-GPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDDAELWTIGS----- 212
            |.|||..| ....|.|.|...|||||:.|||..||||||..|. .|..|.|..|.|.|.:     
plant   190 LNFTRSESILRADIVIGFFSGEHGDGEPFDGAMGTLAHASSPP-TGMLHLDGDEDWLISNGEISR 253

  Fly   213 ---PRGT--NLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGFEPVFKLDEDDKAAIQSLYGRKTN 272
               |..|  :|..||.||.||.|||.||....|:|.|...|.:...:|.:||...||.|||...|
plant   254 RILPVTTVVDLESVAVHEIGHLLGLGHSSVEDAIMFPAISGGDRKVELAKDDIEGIQHLYGGNPN 318

  Fly   273  272
            plant   319  318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773 15/51 (29%)
Peptidase_M10 115..268 CDD:278824 67/165 (41%)
ZnMc_MMP 115..268 CDD:239805 67/165 (41%)
HX 298..493 CDD:238046
AT1G59970NP_176205.1 PG_binding_1 63..114 CDD:366659 15/51 (29%)
Peptidase_M10 151..313 CDD:334067 66/164 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I2423
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 1 1.000 - - FOG0000127
OrthoInspector 1 1.000 - - mtm995
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10201
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X44
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.