DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and AT4G16640

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_193397.1 Gene:AT4G16640 / 827365 AraportID:AT4G16640 Length:364 Species:Arabidopsis thaliana


Alignment Length:326 Identity:118/326 - (36%)
Similarity:142/326 - (43%) Gaps:63/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FSIMAAAQ-SAPVSTTTQAEIYLSQFGYLPASARNPASSGLHD--QRTWVSAIEEFQSFAGLNIT 77
            ||.:...| .:.||..::.:.||.:|||:     |..|....|  .....|||..:|...||.||
plant    55 FSRLVDVQIGSHVSGVSELKRYLHRFGYV-----NDGSEIFSDVFDGPLESAISLYQENLGLPIT 114

  Fly    78 GELDAETMKLMSLPRCGVRDRVGTGDS----RSKRYA-LQGS-RWRVKNLTYKISKYPK--RLKR 134
            |.||..|:.|||||||||.|...|.::    .:..|. ..|. :|....|||.|||..|  .|..
plant   115 GRLDTSTVTLMSLPRCGVSDTHMTINNDFLHTTAHYTYFNGKPKWNRDTLTYAISKTHKLDYLTS 179

  Fly   135 VDVDAEIGRAFAVWS-------EDTDLTFTRKTSGPVHIEIKFVESEHGDGDAFDGQGGTLAHAF 192
            .||.....|||:.||       |:.| .||     ...::|.|...:||||..|||..|||||||
plant   180 EDVKTVFRRAFSQWSSVIPVSFEEVD-DFT-----TADLKIGFYAGDHGDGLPFDGVLGTLAHAF 238

  Fly   193 FPVFGGDAHFDDAELWTI------GSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGFEP 251
            .|. .|..|.|.||.|.:      .|....:|..||.||.||.|||.||.|.||:|.|..|....
plant   239 APE-NGRLHLDAAETWIVDDDLKGSSEVAVDLESVATHEIGHLLGLGHSSQESAVMYPSLRPRTK 302

  Fly   252 VFKLDEDDKAAIQSLYGRKTNQLRPTNVYPATTQRPYSPPKVPLD------DSICKDSKVDTLFN 310
            ...|..||.|.:..|||..                    ||:.||      ||| |:..|...|.
plant   303 KVDLTVDDVAGVLKLYGPN--------------------PKLRLDSLTQSEDSI-KNGTVSHRFL 346

  Fly   311 S 311
            |
plant   347 S 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773 20/57 (35%)
Peptidase_M10 115..268 CDD:278824 67/167 (40%)
ZnMc_MMP 115..268 CDD:239805 67/167 (40%)
HX 298..493 CDD:238046 6/14 (43%)
AT4G16640NP_193397.1 PG_binding_1 68..125 CDD:396175 21/61 (34%)
Peptidase_M10 158..319 CDD:395334 67/167 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I2423
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 1 1.000 - - FOG0000127
OrthoInspector 1 1.000 - - mtm995
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X44
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.