DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and AT2G45040

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_182030.1 Gene:AT2G45040 / 819111 AraportID:AT2G45040 Length:342 Species:Arabidopsis thaliana


Alignment Length:368 Identity:108/368 - (29%)
Similarity:149/368 - (40%) Gaps:84/368 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CQSSVFIVVGTLF---------SIMAAAQSAPVSTTTQAEI-------YLSQFGYLPASARNPAS 52
            |....|..:.:.|         .|:.|...:..:|....::       :|.|:||||.:..:   
plant     8 CNRKPFTTIFSFFLLYLNLHNQQIIEARNPSQFTTNPSPDVSIPEIKRHLQQYGYLPQNKES--- 69

  Fly    53 SGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRV-------GTGDSRSKRYA 110
                |..::..|:..:|...||.|||:.|::|:..:.|||||..|.|       .||    |:|.
plant    70 ----DDVSFEQALVRYQKNLGLPITGKPDSDTLSQILLPRCGFPDDVEPKTAPFHTG----KKYV 126

  Fly   111 -LQG-SRWR---VKNLTYKISK-------YPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRKTSGP 163
             ..| .||.   ...|||..|:       .|..::||     ..|||..|:....::|. :|...
plant   127 YFPGRPRWTRDVPLKLTYAFSQENLTPYLAPTDIRRV-----FRRAFGKWASVIPVSFI-ETEDY 185

  Fly   164 VHIEIK--FVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDDAELWTIG-----SPRGTNLFQV 221
            |..:||  |...:||||:.|||..|.|||.|.|. .|..|.|.||.|.:.     |....:|..|
plant   186 VIADIKIGFFNGDHGDGEPFDGVLGVLAHTFSPE-NGRLHLDKAETWAVDFDEEKSSVAVDLESV 249

  Fly   222 AAHEFGHSLGLSHSDQSSALMAPFYRGFEPVFKLDEDDKAAIQSLYGRKTNQLRPTNVYPATTQR 286
            |.||.||.|||.||....|.|.|..:.......|:.||...:|||||        ||        
plant   250 AVHEIGHVLGLGHSSVKDAAMYPTLKPRSKKVNLNMDDVVGVQSLYG--------TN-------- 298

  Fly   287 PYSPPKVPLDDSICKDSKVDTLFNSAQGETYAFKGDKYYKLTT 329
                |...|:..:..    :|..|.|.|.....:|..|..|:|
plant   299 ----PNFTLNSLLAS----ETSTNLADGSRIRSQGMIYSTLST 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773 16/62 (26%)
Peptidase_M10 115..268 CDD:278824 60/169 (36%)
ZnMc_MMP 115..268 CDD:239805 60/169 (36%)
HX 298..493 CDD:238046 8/32 (25%)
AT2G45040NP_182030.1 PG_binding_1 45..101 CDD:396175 16/62 (26%)
Peptidase_M10 133..296 CDD:395334 60/169 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I2423
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 1 1.000 - - FOG0000127
OrthoInspector 1 1.000 - - mtm995
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X44
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.