DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and mmp16a

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:XP_021326042.1 Gene:mmp16a / 564419 ZFINID:ZDB-GENE-070820-1 Length:344 Species:Danio rerio


Alignment Length:304 Identity:98/304 - (32%)
Similarity:148/304 - (48%) Gaps:44/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 MAPFYRGFEPV-FKLDEDDKAAIQSLYGRKTNQLRPTN-------------VYPATTQRPYSPPK 292
            |||||:..:.. |:|..||...||.:||......:||.             |.|....|...||:
Zfish     1 MAPFYQYMDTENFRLPHDDLQGIQKIYGPPDKLPQPTRPSPTVPPARSHPPVDPRKNDRQTRPPR 65

  Fly   293 VPLDD---------SICKDSKVDTLFNS---AQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWP 345
            :|..|         .||     |..||:   .:.|.:.||...::::..::|..|||.||:..|.
Zfish    66 IPTGDKPTHPNAKPDIC-----DGGFNTLAILRREMFVFKDHWFWRVRDNAVMPGYPMLINVFWR 125

  Fly   346 GLPGNIDAAFTYKNGKTYFFKGTQYWRYQGRQMDGVYPKEISEGFTGIP-DHLDAAMVWGGNGKI 409
            |||..|||.:....||..||||.|:|.::...:...||::|:....|:| ..::.|:.|....|.
Zfish   126 GLPPKIDAVYENSKGKFVFFKGKQFWVFKDTMLLPGYPQDITMFGNGMPAQSIEMAVWWEDVAKT 190

  Fly   410 YFFKGSKFWRFDPAKRPPVKASYPKPISNWEGVPNNLDAA-LKYTNGYTYFFKGDKYYRFHDARF 473
            |||||.::||::...| .:...|||.|:.|:|||::...| :...||:|||:||.:|::|::.|.
Zfish   191 YFFKGDRYWRYNEDMR-TMDPGYPKSITVWKGVPDSPQGAFVDKANGFTYFYKGKEYWKFNNHRL 254

  Fly   474 AVDSATPPFPRPTAHWWFGCKNTP-------SSTGNIVEGSDNE 510
            .|:   |.:||.....:.||...|       :...|.|...|||
Zfish   255 RVE---PGYPRSILKDFMGCDLVPIDPDLHATEDKNEVIKLDNE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773
Peptidase_M10 115..268 CDD:278824 11/26 (42%)
ZnMc_MMP 115..268 CDD:239805 11/26 (42%)
HX 298..493 CDD:238046 68/199 (34%)
mmp16aXP_021326042.1 Peptidase_M10 <1..28 CDD:332519 11/26 (42%)
HX 79..271 CDD:238046 68/200 (34%)
DUF3377 284..344 CDD:314687 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.