DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and MMP14

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_004986.1 Gene:MMP14 / 4323 HGNCID:7160 Length:582 Species:Homo sapiens


Alignment Length:601 Identity:221/601 - (36%)
Similarity:312/601 - (51%) Gaps:84/601 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CQSSVFIVVGTLFSIMAAAQSAPVSTTTQAEIYLSQFGYLPASARNPASSGLHDQRTWVS---AI 65
            |.....:.:||..:.:.:|||:..|    .|.:|.|:||||     |.....|.||:..|   ||
Human    10 CLLLPLLTLGTALASLGSAQSSSFS----PEAWLQQYGYLP-----PGDLRTHTQRSPQSLSAAI 65

  Fly    66 EEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGT---GDSRSKRYALQGSRWRVKNLTYKISK 127
            ...|.|.||.:||:.||:|||.|..|||||.|:.|.   .:.|.||||:||.:|:...:|:.|..
Human    66 AAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQN 130

  Fly   128 YPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRKTSGPVH--------IEIKFVESEHGDGDAFDGQ 184
            |..::........|.:||.||...|.|.|.......:.        |.|.|.|..|||...|||:
Human   131 YTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGE 195

  Fly   185 GGTLAHAFF--PVFGGDAHFDDAELWTIGSP--RGTNLFQVAAHEFGHSLGLSHSDQSSALMAPF 245
            ||.||||:|  |..|||.|||.||.||:.:.  .|.::|.||.||.||:|||.||...||:||||
Human   196 GGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPF 260

  Fly   246 YRGFEPV-FKLDEDDKAAIQSLYGRKTNQLRPTNV--YPATTQRPYSP--PKVP-LDDSICKDSK 304
            |:..:.. |.|.:||:..||.|||.::.  .||.:  .|.||.||..|  ||.| ...:|| |..
Human   261 YQWMDTENFVLPDDDRRGIQQLYGGESG--FPTKMPPQPRTTSRPSVPDKPKNPTYGPNIC-DGN 322

  Fly   305 VDTLFNSAQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAAFTYKNGKTYFFKGTQ 369
            .||: ...:||.:.||...::::..:.|.:|||..|.:.|.|||.:|:.|:..|:||..||||.:
Human   323 FDTV-AMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDK 386

  Fly   370 YWRYQGRQMDGVYPKEISEGFTGIP-DHLDAAMVWGGNGKIYFFKGSKFWRFDPAKRPPVKASYP 433
            :|.:....::..|||.|.|...|:| |.:|||:.|..|||.|||:|:|::||:...| .|.:.||
Human   387 HWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELR-AVDSEYP 450

  Fly   434 KPISNWEGVPNNLDAALKYTNG-YTYFFKGDKYYRFHDARFAVDSATPPFPRPTAHWWFGCKNTP 497
            |.|..|||:|.:...:...::. :|||:||:||::|::.:..|:   |.:|:.....|.||   |
Human   451 KNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVE---PGYPKSALRDWMGC---P 509

  Fly   498 SSTGNIVEGSDNEFEQHSMIPHADDGNGDDFDAAVGDHQSNDEPIVPEVAERTGNGAMSQSKLTS 562
            |. |...||::.|                            .|.|:.||.|. |.||:       
Human   510 SG-GRPDEGTEEE----------------------------TEVIIIEVDEE-GGGAV------- 537

  Fly   563 SSAVSTVITTILMCLV 578
             ||.:.|:..:|:.||
Human   538 -SAAAVVLPVLLLLLV 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773 25/58 (43%)
Peptidase_M10 115..268 CDD:278824 67/165 (41%)
ZnMc_MMP 115..268 CDD:239805 67/165 (41%)
HX 298..493 CDD:238046 72/196 (37%)
MMP14NP_004986.1 PG_binding_1 36..88 CDD:279773 25/56 (45%)
Peptidase_M10 118..284 CDD:278824 67/165 (41%)
ZnMc_MMP 118..284 CDD:239805 67/165 (41%)
HX 316..508 CDD:238046 72/197 (37%)
DUF3377 <560..582 CDD:288690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4381
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H21040
Inparanoid 1 1.050 337 1.000 Inparanoid score I2388
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40364
orthoMCL 1 0.900 - - OOG6_101521
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3504
SonicParanoid 1 1.000 - - X44
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.