DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and vtnb

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001132933.1 Gene:vtnb / 403026 ZFINID:ZDB-GENE-041116-1 Length:449 Species:Danio rerio


Alignment Length:363 Identity:102/363 - (28%)
Similarity:135/363 - (37%) Gaps:140/363 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 KTNQLRPTNVYPATTQRPYSPPKVPLD-DSI-CKDSKVDTLFNSAQGETYAFKGDKYYKLTTDSV 332
            :|| |..|...|.||..||..|..|.| |:: |.....|.......|..:||:||.:::|...||
Zfish    81 ETN-LTVTTALPTTTAAPYVSPTAPPDPDAVTCSRRTFDAFMQLKNGSIFAFRGDYFFELDDRSV 144

  Fly   333 EEGYPQLISKGWPGLPGNIDAAFTYKN--GKTYFFKGTQYWRYQGRQMDGVYPKEISEGFTGIPD 395
            ..|||:||...| |:.|.||||||..|  ||||.|||.:|||:.|..:|..||::|:.||..|||
Zfish   145 MPGYPKLIKDVW-GINGPIDAAFTRINCQGKTYIFKGNKYWRFDGDVLDEDYPRDIAVGFEKIPD 208

  Fly   396 HLDAAMV-----WGGNGKIYFFKGSKFWRFDPAKRPP-------VKAS-----------Y----- 432
            .:|||..     ..|..|:|||||.::::::...:|.       .|:|           |     
Zfish   209 DVDAAFAIPAPGHHGREKVYFFKGDQYYQYEFKHQPSHEECDRMTKSSPSVAFTRYTDLYCDFDI 273

  Fly   433 --------------PKPIS-NWEGVPNNLDAA--------------------------------- 449
                          |:.|| :|.|:...:|||                                 
Zfish   274 FDLVFQGAQGHHKGPRFISKDWIGIKPPVDAAMVGRLYVNSSPSPSPSTSLSRGQNTRRRLRGSK 338

  Fly   450 -------------LKYTNGY--------------------------------------------- 456
                         |.|...|                                             
Zfish   339 ARVSRSLFWEDFGLDYEERYFGTEKQGKKQKKGRGRRPSLFDMSYDPMDYVDVEVVQEKATPVQN 403

  Fly   457 TYFFKGDKYYRFHDARFAVDSATPPFPRPTAHWWFGCK 494
            .||||.|||||.......:|..|||:||....:|.|||
Zfish   404 VYFFKKDKYYRVDLQTKRIDRVTPPYPRSIGKYWLGCK 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773
Peptidase_M10 115..268 CDD:278824
ZnMc_MMP 115..268 CDD:239805
HX 298..493 CDD:238046 86/331 (26%)
vtnbNP_001132933.1 Somatomedin_B 19..56 CDD:279385
HX 112..440 CDD:238046 86/328 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.