Sequence 1: | NP_726473.2 | Gene: | Mmp1 / 37949 | FlyBaseID: | FBgn0035049 | Length: | 584 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001132933.1 | Gene: | vtnb / 403026 | ZFINID: | ZDB-GENE-041116-1 | Length: | 449 | Species: | Danio rerio |
Alignment Length: | 363 | Identity: | 102/363 - (28%) |
---|---|---|---|
Similarity: | 135/363 - (37%) | Gaps: | 140/363 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 270 KTNQLRPTNVYPATTQRPYSPPKVPLD-DSI-CKDSKVDTLFNSAQGETYAFKGDKYYKLTTDSV 332
Fly 333 EEGYPQLISKGWPGLPGNIDAAFTYKN--GKTYFFKGTQYWRYQGRQMDGVYPKEISEGFTGIPD 395
Fly 396 HLDAAMV-----WGGNGKIYFFKGSKFWRFDPAKRPP-------VKAS-----------Y----- 432
Fly 433 --------------PKPIS-NWEGVPNNLDAA--------------------------------- 449
Fly 450 -------------LKYTNGY--------------------------------------------- 456
Fly 457 TYFFKGDKYYRFHDARFAVDSATPPFPRPTAHWWFGCK 494 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mmp1 | NP_726473.2 | PG_binding_1 | 32..88 | CDD:279773 | |
Peptidase_M10 | 115..268 | CDD:278824 | |||
ZnMc_MMP | 115..268 | CDD:239805 | |||
HX | 298..493 | CDD:238046 | 86/331 (26%) | ||
vtnb | NP_001132933.1 | Somatomedin_B | 19..56 | CDD:279385 | |
HX | 112..440 | CDD:238046 | 86/328 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1565 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |