DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and hpxa

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001315463.1 Gene:hpxa / 327588 ZFINID:ZDB-GENE-030131-5773 Length:447 Species:Danio rerio


Alignment Length:270 Identity:70/270 - (25%)
Similarity:112/270 - (41%) Gaps:55/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 CKDSKVDTLFNSAQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLP-----GNIDAAFTYKN 359
            ||..:.|.:..:.:|..|.||||..:|     ...|..:|.:|.:|.|.     |::||||...:
Zfish    51 CKGIEFDAVAVNEEGVPYFFKGDHLFK-----GFHGKAELSNKTFPELDDHHHLGHVDAAFRMHS 110

  Fly   360 GKT-------YFFKGTQYWRYQGRQMDGVYPKEISEGFTGIPDHLDAAMVWG----GNGKIYFFK 413
            ..:       :||.....:.|...:::..|||.||..|.|||||||||:...    .|..:.|||
Zfish   111 EDSPDHHDHQFFFLDNMVFSYFKHKLEKDYPKLISAVFPGIPDHLDAAVECPKPDCPNDTVIFFK 175

  Fly   414 GSKFWRFDPAKRPPVKASYPKPI--SNWEGVPNNLDAALKYTNGYTYFFKGDKYYRFHDARFAVD 476
            |.:.:.|:         .:.|.:  ..::.:| |...|.:|. |:.|.|.|.::.:|......|.
Zfish   176 GDEIYHFN---------MHTKKVDEKEFKSMP-NCTGAFRYM-GHYYCFHGHQFSKFDPMTGEVH 229

  Fly   477 SATPPFPRPTAHWWFGCKNTPSSTGNIVEGSDNEFEQH-------SMIPHADDGN-----GDDFD 529
            .   .:|:....::..|.:..|.|      :|:..|:.       ..|...|.||     |..|.
Zfish   230 G---KYPKEARDYFMRCPHFGSKT------TDDHIEREQCSRVHLDAITSDDAGNIYAFRGHHFL 285

  Fly   530 AAVGDHQSND 539
            :..||...:|
Zfish   286 SITGDKFHSD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773
Peptidase_M10 115..268 CDD:278824
ZnMc_MMP 115..268 CDD:239805
HX 298..493 CDD:238046 56/210 (27%)
hpxaNP_001315463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..44
HX 49..243 CDD:238046 56/210 (27%)
Hemopexin 1 53..93 12/44 (27%)
Hemopexin 2 99..151 14/51 (27%)
Hemopexin 3 152..197 14/53 (26%)
Hemopexin 4 198..243 11/49 (22%)
HX 257..445 CDD:295316 9/39 (23%)
Hemopexin 5 262..304 9/34 (26%)
Hemopexin 6 305..351
Hemopexin 7 352..395
Hemopexin 8 396..441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.