DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and Vtn

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_062029.2 Gene:Vtn / 29169 RGDID:3967 Length:478 Species:Rattus norvegicus


Alignment Length:414 Identity:110/414 - (26%)
Similarity:154/414 - (37%) Gaps:170/414 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 VFKLDEDD--------------KAAIQS--------LYGRKTNQLRPTNVYP---ATTQRP---- 287
            ||.:.||:              ...:||        |..|....::||...|   :.||.|    
  Rat    67 VFTMPEDEYWSYDYPEETKNSTSTGVQSENTSLHFNLKPRAEETIKPTTPDPQEQSNTQEPEVGQ 131

  Fly   288 --YSPPKVPLD--------DSICKDSKVDTLFNSAQGETYAFKGDKYYKLTTDSVEEGYPQLISK 342
              .:|.....|        :.:|.....|...:...|..:||:|:..|:|...:|..|||:||..
  Rat   132 QGVAPRPDTTDEGTSEFPEEELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQD 196

  Fly   343 GWPGLPGNIDAAFTYKN--GKTYFFKGTQYWRYQGRQMDGVYPKEISEGFTGIPDHLDAAMV--- 402
            .| |:.|.||||||..|  ||||.|||:||||::...:|..||:.|||||:||||::|||:.   
  Rat   197 VW-GIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISEGFSGIPDNVDAALALPA 260

  Fly   403 --WGGNGKIYFFKGSKFWRFDPAKRPPVK------------------------------------ 429
              :.|..::|||||.::|.::..::|..:                                    
  Rat   261 HSYSGRERVYFFKGKQYWEYEFQQQPSQEECEGSSLSAVFEHFALLQRDSWENIFELLFWGRSSD 325

  Fly   430 -ASYPKPIS-NWEGVPNNLDAALK---YTNGYT-------------------------------- 457
             |..|:.|| :|.|||..:|||:.   |..|.|                                
  Rat   326 GAKGPQFISRDWHGVPGKVDAAMAGRIYITGSTFRSVQAKKQKSGRRSRKRYRSRRGRGHSRSRS 390

  Fly   458 -----------------------------------------------YFFKGDKYYRFHDARFAV 475
                                                           |||.||||||.:.....|
  Rat   391 RSMSSRRPSRSVWFSLLSSEESGLGTYNYDYDMNWRIPATCEPIQSVYFFSGDKYYRVNLRTRRV 455

  Fly   476 DSATPPFPRPTAHWWFGCKNTPSS 499
            ||..||:||..|.:|.||   |:|
  Rat   456 DSVNPPYPRSIAQYWLGC---PTS 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773
Peptidase_M10 115..268 CDD:278824 7/37 (19%)
ZnMc_MMP 115..268 CDD:239805 7/37 (19%)
HX 298..493 CDD:238046 90/321 (28%)
VtnNP_062029.2 SO 20..62 CDD:197571
HX 152..473 CDD:238046 90/321 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.