DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and Prg4

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001099432.4 Gene:Prg4 / 289104 RGDID:1308976 Length:1275 Species:Rattus norvegicus


Alignment Length:289 Identity:77/289 - (26%)
Similarity:113/289 - (39%) Gaps:80/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 QLRP-TNVYPATTQRPYSPPKVPLDDSICKDSKVDTLFNSAQGETYAFKGDKYYKLTTDSVEEGY 336
            :|.| .|::|..:.          :.:||....||.|.....|...||:| .|:.:.........
  Rat   998 RLNPGINIHPMFSD----------ETNICNGKPVDGLTTLRNGTLVAFRG-HYFWMLNPFRPPSP 1051

  Fly   337 PQLISKGWPGLPGNIDAAFTYKN--GKTYFFKGTQYWRYQGRQMDGVYPKEISEGFTGIPDHLDA 399
            |:.|::.| |:|..||..||..|  |||:|||.:||||:....||..|||.|.:||.|:...:.|
  Rat  1052 PRRITEVW-GIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDVMDAGYPKLIVKGFGGLTGKIVA 1115

  Fly   400 AM-----------VW----GGNGKIYFFKGS-----------------------KFWRFDPAKRP 426
            |:           |:    |||.:.|.:|..                       :..||:.|..|
  Rat  1116 ALSIAKYKDRPESVYFFKRGGNIQQYTYKQEPVRKCTGRQPAINYSVYGQAAQVRRRRFERAVGP 1180

  Fly   427 ------------PVKASYP---------KPISNWEGVPNNLDAALKYTN-----GYTYF-FKGDK 464
                        |:||||.         |..:.|.|.||.:.:|:...|     ||.|: |..|:
  Rat  1181 FQTHTFRIHYSVPIKASYQDKGFLHNEVKVSTLWRGFPNVVTSAITLPNIRKPDGYDYYAFSKDQ 1245

  Fly   465 YYRFHDARFAVDSATPPFPRPTAHWWFGC 493
            ||..........:.|....:..:..|:.|
  Rat  1246 YYNIDVPTRTARAITTRSGQTLSRVWYNC 1274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773
Peptidase_M10 115..268 CDD:278824
ZnMc_MMP 115..268 CDD:239805
HX 298..493 CDD:238046 72/261 (28%)
Prg4NP_001099432.4 SO 26..68 CDD:197571
SO 67..108 CDD:197571
PHA03247 <315..724 CDD:223021
HX 1013..1274 CDD:238046 72/262 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.