DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and Mmp23

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:XP_006538942.1 Gene:Mmp23 / 26561 MGIID:1347361 Length:420 Species:Mus musculus


Alignment Length:358 Identity:91/358 - (25%)
Similarity:132/358 - (36%) Gaps:122/358 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SRSKRYALQGS--RWRVKNLTY-----------------------------KISKYPKR-LKRVD 136
            :|.:||.|..:  ||...||||                             ::..:|:. |...:
Mouse    75 TRRRRYTLTPARLRWDHFNLTYRCHLDQRGGWSGHNSDTNTDSNITAALHHRVLSFPRNLLSPEE 139

  Fly   137 VDAEIGRAFAVWSEDTDLTFTR-KTSGPVHIEIKFVESEHGD------GDAFDGQGGTLAHAFFP 194
            ....:..||.:||:.:..:|.. ....|..::|.|....|.|      ...|||..|.|||||||
Mouse   140 TRRGLAAAFRMWSDVSPFSFREVAPERPSDLKIGFYPVNHTDCLVSAVHHCFDGPTGELAHAFFP 204

  Fly   195 VFGGDAHFDDAELWTIGSPRG--------TNLFQVAAHEFGHSLGLSHSDQSSALM--APFYRGF 249
            ..|| .||||:|.|.:|..|.        |||..|||||.||:|||.||.|..|||  ....||:
Mouse   205 PHGG-IHFDDSEYWVLGPTRYSWKKGVWLTNLVHVAAHEIGHALGLMHSQQDQALMHLNATLRGW 268

  Fly   250 EPVFKLDEDDKAAIQSLYGRKTNQLRPTNVYPATTQRPYSPPKVPLDDSICKDSKVDTLFNSAQG 314
            :   .|.:|:...:..|||                               |    :|.:|..|  
Mouse   269 K---ALSQDELWGLHRLYG-------------------------------C----LDRIFVCA-- 293

  Fly   315 ETYAFKG-----------------DKYYKL------TTDSVEEGYPQLISKGWPGLPGNIDAAFT 356
             ::|.||                 |..|:.      ||.|......:|:.:| ..:..:......
Mouse   294 -SWARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVATTTSPTRTKTRLVREG-RNMTFHCGQKIL 356

  Fly   357 YKNGKTYFFKGTQYWRYQGRQMDGVYPKEISEG 389
            :|.||.|::|..:       .::..||..::.|
Mouse   357 HKKGKVYWYKDQE-------PLEFSYPGYLALG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773
Peptidase_M10 115..268 CDD:278824 63/199 (32%)
ZnMc_MMP 115..268 CDD:239805 63/199 (32%)
HX 298..493 CDD:238046 22/115 (19%)
Mmp23XP_006538942.1 ZnMc_MMP 88..284 CDD:239805 63/199 (32%)
ShKT 285..319 CDD:214586 8/40 (20%)
Ig 343..403 CDD:386229 9/48 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.