DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and Mmp7

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_036996.1 Gene:Mmp7 / 25335 RGDID:3100 Length:267 Species:Rattus norvegicus


Alignment Length:284 Identity:111/284 - (39%)
Similarity:138/284 - (48%) Gaps:27/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNCQSSVFIVVGTLFSIMAAAQSAPVSTTT-----QAEIYLSQFGYLPASARNPASSGLHDQRT 60
            |...:.::|.:|..|...:|...|......|     ||:.||.:| ||..|....|:|.      
  Rat     1 MAAMRLTLFRIVCLLPGCLALPLSQEAGEVTALQWEQAQNYLRKF-YLHDSKTKKATSA------ 58

  Fly    61 WVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYAL--QGSRWRVKNLTY 123
             |..:.|.|.|.||..||:|....|::|..|||||.|        ...::|  ...:|..:.:||
  Rat    59 -VDKLREMQKFFGLPETGKLSPRVMEIMQKPRCGVPD--------VAEFSLMPNSPKWHSRTVTY 114

  Fly   124 KISKYPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRKTSGPVHIEIKFVESEHGDGDAFDGQGGTL 188
            :|..|...|.|..||..:.||..:||....|.|.|.:.|...|.|.|...:|||...|||.|.||
  Rat   115 RIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTL 179

  Fly   189 AHAFF--PVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRG-FE 250
            .|||.  |..|||||||..|.||.|...|.|...||.||.||||||.||...|::|.|.|:| ..
  Rat   180 GHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHS 244

  Fly   251 PVFKLDEDDKAAIQSLYGRKTNQL 274
            ..|.|.:||.|.||.||| |.|:|
  Rat   245 EDFSLTKDDIAGIQKLYG-KRNKL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773 20/55 (36%)
Peptidase_M10 115..268 CDD:278824 71/155 (46%)
ZnMc_MMP 115..268 CDD:239805 71/155 (46%)
HX 298..493 CDD:238046
Mmp7NP_036996.1 PG_binding_1 34..85 CDD:396175 20/58 (34%)
Cysteine switch. /evidence=ECO:0000250 88..95 6/14 (43%)
Peptidase_M10 106..262 CDD:395334 71/155 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 1 1.000 - - FOG0000127
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X44
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.