DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and W01F3.2

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_507992.1 Gene:W01F3.2 / 180351 WormBaseID:WBGene00012185 Length:307 Species:Caenorhabditis elegans


Alignment Length:259 Identity:55/259 - (21%)
Similarity:95/259 - (36%) Gaps:78/259 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LFQVAAH-------------------EFGHSLGLSHSDQ---SSALMAPFYRGFEPVFKLDEDDK 260
            |..||||                   ..|..:.:.|:|:   :..::.||.   :|.........
 Worm     6 LLLVAAHVANGLFGFGEKKTTQAPKISLGSEISIPHTDEDQDTGEIVIPFN---DPSTTTTRRRT 67

  Fly   261 AA-----IQSLYG------RKTNQLR--PTNVYP---ATTQRPYSPPKVPLDD----SICKDSKV 305
            |.     :.|:.|      |.|..:|  .|.:.|   |.|:|      :|..|    |.| .:::
 Worm    68 ATTTGIPVISVGGIGLDRTRSTVDVRSFTTTINPRFTAATKR------LPSSDRHSSSGC-PNRI 125

  Fly   306 DTLFNSAQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAA---------FTYKNGK 361
            |. :.......|||...:.:|::.:.:.: ...|:.:...| |..::.|         :......
 Worm   126 DA-YTFGPDSDYAFYEQQVFKISNNRISD-RTTLVEEFKDG-PNQVNGALYDPEREILWLVDGRS 187

  Fly   362 TYFFK--GTQYWRYQGRQMDGVYPKEI--SEGFTGIPDHLDAAMVWGGNGKIYFFKGSKFWRFD 421
            .|.:|  |:..|:.|     .|:|||:  |.|||.     :||:.|....::....|.||..:|
 Worm   188 VYGYKKDGSDNWKLQ-----SVFPKELPSSIGFTP-----EAAVRWHNKHQLLLSNGGKFALYD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773
Peptidase_M10 115..268 CDD:278824 13/76 (17%)
ZnMc_MMP 115..268 CDD:239805 13/76 (17%)
HX 298..493 CDD:238046 31/137 (23%)
W01F3.2NP_507992.1 HX 122..299 CDD:295316 29/133 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000127
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.