DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and Mmp7

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_034940.2 Gene:Mmp7 / 17393 MGIID:103189 Length:267 Species:Mus musculus


Alignment Length:285 Identity:107/285 - (37%)
Similarity:139/285 - (48%) Gaps:36/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNCQSSVFIVVGTL---FSIMAAAQSAPVST--TTQAEIYLSQFGYLPASARNPASSGLHDQRT 60
            |...|.::|..|..|   .::..:.::..||.  ..||:.||.:|  .|           ||.:|
Mouse     1 MAAMQLTLFCFVCLLPGHLALPLSQEAGDVSAHQWEQAQNYLRKF--YP-----------HDSKT 52

  Fly    61 -----WVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYAL--QGSRWRV 118
                 .|..::|.|.|.||.:||:|....|::|..|||||.|        ...|:|  ...:|..
Mouse    53 KKVNSLVDNLKEMQKFFGLPMTGKLSPYIMEIMQKPRCGVPD--------VAEYSLMPNSPKWHS 109

  Fly   119 KNLTYKISKYPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRKTSGPVHIEIKFVESEHGDGDAFDG 183
            :.:||:|..|...|.|:.||..:.:|..:||....|.|.|.:.|...|.|.|...:|||...|||
Mouse   110 RIVTYRIVSYTSDLPRIVVDQIVKKALRMWSMQIPLNFKRVSWGTADIIIGFARRDHGDSFPFDG 174

  Fly   184 QGGTLAHAFF--PVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFY 246
            .|.||.|||.  |..|||||||..|.||.|...|.|....|.||||||||||||.....:|.|.|
Mouse   175 PGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDAGVNFLFAATHEFGHSLGLSHSSVPGTVMYPTY 239

  Fly   247 -RGFEPVFKLDEDDKAAIQSLYGRK 270
             |.:...|.|.:||.|.||.|||::
Mouse   240 QRDYSEDFSLTKDDIAGIQKLYGKR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773 19/60 (32%)
Peptidase_M10 115..268 CDD:278824 70/155 (45%)
ZnMc_MMP 115..268 CDD:239805 70/155 (45%)
HX 298..493 CDD:238046
Mmp7NP_034940.2 PG_binding_1 34..85 CDD:279773 19/63 (30%)
Peptidase_M10 106..262 CDD:278824 70/155 (45%)
ZnMc_MMP 106..262 CDD:239805 70/155 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4397
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 1 1.000 - - FOG0000127
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X44
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.