DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and Y50D7A.13

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001299905.1 Gene:Y50D7A.13 / 13188188 WormBaseID:WBGene00194737 Length:194 Species:Caenorhabditis elegans


Alignment Length:179 Identity:49/179 - (27%)
Similarity:77/179 - (43%) Gaps:34/179 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RWRVKNLTYKISKYPKRLKRV----DVDAEIGRAFAVWS---------EDTDLTFTRKTSGPVHI 166
            ||..:.:|:..|. |.||...    .|...:..|.|.|:         |:..:.      ....|
 Worm    26 RWSHRRITWSFSD-PFRLLTAHQFQGVRLTVQEAVARWAIALEGLVEFEEVPVV------DAADI 83

  Fly   167 EIKFVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDDAELWTI-------GSPRGTNLFQVAAH 224
            .:.|.:..|...:.|||:||.:||:.:|.: |..|.|..|.|..       .:.:..:|..|..|
 Worm    84 TVLFAKKNHSCYEEFDGKGGVVAHSMYPPY-GVLHLDGDEEWHTRRWEEDGEASKYIDLRLVLIH 147

  Fly   225 EFGHSLGLSHSDQSSALMAPFYRGFEPV----FKLDEDDKAAIQSLYGR 269
            |.||:|||.||.:.:::|...|.  :|.    .:|.:.|..||:.|||:
 Worm   148 EIGHTLGLRHSRRKTSVMRKHYE--KPAKIGKIQLSKYDIRAIRKLYGQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773
Peptidase_M10 115..268 CDD:278824 47/176 (27%)
ZnMc_MMP 115..268 CDD:239805 47/176 (27%)
HX 298..493 CDD:238046
Y50D7A.13NP_001299905.1 ZnMc_MMP 26..193 CDD:239805 47/176 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101521
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.