| Sequence 1: | NP_726473.2 | Gene: | Mmp1 / 37949 | FlyBaseID: | FBgn0035049 | Length: | 584 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_005798.3 | Gene: | PRG4 / 10216 | HGNCID: | 9364 | Length: | 1404 | Species: | Homo sapiens |
| Alignment Length: | 299 | Identity: | 78/299 - (26%) |
|---|---|---|---|
| Similarity: | 112/299 - (37%) | Gaps: | 83/299 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 274 LRPTNVYPATTQRPYSPPKVP---------LDD--SICKDSKVDTLFNSAQGETYAFKGDKYYKL 327
Fly 328 TTDSVEEGYPQLISKGWPGLPGNIDAAFTYKN--GKTYFFKGTQYWRYQGRQMDGVYPKEISEGF 390
Fly 391 TGIPDHLDAAMV------WGGNGKIYFFK-GSKFWRF---------DPAKRP------------- 426
Fly 427 ----------------------PVKASYP---------KPISNWEGVPNNLDAALKYTN-----G 455
Fly 456 YTYF-FKGDKYYRFHDARFAVDSATPPFPRPTAHWWFGC 493 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Mmp1 | NP_726473.2 | PG_binding_1 | 32..88 | CDD:279773 | |
| Peptidase_M10 | 115..268 | CDD:278824 | |||
| ZnMc_MMP | 115..268 | CDD:239805 | |||
| HX | 298..493 | CDD:238046 | 67/262 (26%) | ||
| PRG4 | NP_005798.3 | SO | 26..68 | CDD:197571 | |
| SO | 66..108 | CDD:197571 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 111..966 | ||||
| SSL_OB | 304..>441 | CDD:332684 | |||
| 59 X 8 AA repeats of K-X-P-X-P-T-T-X | 348..855 | ||||
| Atrophin-1 | <374..839 | CDD:331285 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 992..1104 | ||||
| HX | 1143..1403 | CDD:238046 | 67/263 (25%) | ||
| Hemopexin 1 | 1148..1191 | 11/44 (25%) | |||
| Hemopexin 2 | 1192..1239 | 23/46 (50%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1565 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||