DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and mmp23ba

DIOPT Version :9

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:XP_009302611.1 Gene:mmp23ba / 101882601 ZFINID:ZDB-GENE-030131-9548 Length:371 Species:Danio rerio


Alignment Length:294 Identity:88/294 - (29%)
Similarity:122/294 - (41%) Gaps:73/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SRSKRYAL--QGSRWRVKNLTYKISKYPKR-LKRVDVDAEIGRAFAVWSEDTDLTFTRKTSG-PV 164
            ||:|||.|  :..:|....:|||:..:|:. |...|....|.:||::||:.:..:|....|. ..
Zfish    55 SRNKRYTLTPEKLKWDNFKMTYKLLSFPRNLLNATDTRRGISKAFSMWSDVSPFSFREVPSDQEA 119

  Fly   165 HIEIKFVESEHGD------GDAFDGQGGTLAHAFFPVFGGDAHFDDAELWTIGSPRG-------- 215
            .|:|.|....|.|      ...|||..|.|||||||. .|:.||||.|.|.:|:.|.        
Zfish   120 DIKIGFYSVNHTDCLHSHLHHCFDGITGELAHAFFPQ-TGEIHFDDDEYWILGNMRFSWNKGVWL 183

  Fly   216 TNLFQVAAHEFGHSLGLSHSDQSSALM--APFYRGFEPVFKLDEDDKAAIQSLYG---------- 268
            |:|..|||||.||.|||.||....|||  .....|.:   .:.:|:...:..|||          
Zfish   184 TDLVHVAAHEIGHVLGLMHSQNPKALMHLNATLTGRK---LITQDEVWGLHRLYGCLDRFFICPS 245

  Fly   269 ----------RKTNQLR-PTNV-----YPATTQRP-YSPPKVPLDDSICKDSKVDTLFNSAQGET 316
                      ||..|.. |::.     :|..|.|| .:||:.       |...|      .:|:.
Zfish   246 WARKGYCDSKRKLMQKHCPSSCDFCYEFPFPTARPTTAPPRT-------KHKFV------VEGKN 297

  Fly   317 YAF---------KGDKYYKLTTDSVEEGYPQLIS 341
            ..|         ||..|:....:.:|..:|..||
Zfish   298 LTFRCGKKIAAKKGKIYWYKDGELLEFSHPGYIS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:279773
Peptidase_M10 115..268 CDD:278824 59/170 (35%)
ZnMc_MMP 115..268 CDD:239805 59/170 (35%)
HX 298..493 CDD:238046 11/53 (21%)
mmp23baXP_009302611.1 Peptidase_M10 68..235 CDD:278824 59/170 (35%)
ZnMc_MMP 68..235 CDD:239805 59/170 (35%)
ShKT 236..270 CDD:214586 4/33 (12%)
IG_like 292..369 CDD:214653 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.