DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and RBM8A

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_005096.1 Gene:RBM8A / 9939 HGNCID:9905 Length:174 Species:Homo sapiens


Alignment Length:163 Identity:39/163 - (23%)
Similarity:78/163 - (47%) Gaps:32/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLKDDAAESQSQPETGVRKRR-NPFNTQ-----RLKEEKE-----------RRQKKRARLIVRNI 55
            ::.:|..||..:.:...:||: ..|.::     |::|:.:           :|..:...|.|..:
Human    16 AMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGV 80

  Fly    56 SYKSTEDSLREHFGQWGTLEDVHI-LKRGDGKLVGCAFVQYETINQATKAILNSNGKELLGRKVF 119
            ..::||:.:.:.|.::|.::::|: |.|..|.|.|...|:|||..:|..|:...||::|:|:.:.
Human    81 HEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPIS 145

  Fly   120 VDWALGKDEYVSKNPK---------DEEPDEKK 143
            |||.     :|...||         ...||.::
Human   146 VDWC-----FVRGPPKGKRRGGRRRSRSPDRRR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 25/75 (33%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
RBM8ANP_005096.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 9/53 (17%)
RRM_RBM8 67..151 CDD:409762 26/88 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..174 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.