DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and WHI3

DIOPT Version :9

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_014202.1 Gene:WHI3 / 855524 SGDID:S000005141 Length:661 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:48/244 - (19%)
Similarity:89/244 - (36%) Gaps:53/244 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 ADGVSASDMAKRHELEQVKTQVLKNLNRFVSRNRLSIHNLPQNYD---NEKLKQMALTYTGFRPH 407
            |:||.:.::.|::....:.:..|::.|......|..:.||..||.   |.|.:....::      
Yeast   125 AEGVKSIELQKKNSSSSITSASLEDENDIFIIARFELLNLAINYAVILNSKNELFGPSF------ 183

  Fly   408 ECRVMREHKVTPEHPQGKSKGFGFLSF-------DTHQRALAALRKLNN---NPNIFGTQSRPIV 462
                  .:|.|.|.....:|  ..:||       ||     :.|.|.|:   .|::...:||   
Yeast   184 ------PNKTTVEIIDDTTK--NLVSFPSSAIFNDT-----SRLNKSNSGMKRPSLLSQRSR--- 232

  Fly   463 AFSIEDRAVHKIKEKRTERSKQNNPTYQNKQQERKERRQQKRNGQETKTPVPQADNKSKLQKHIK 527
             ||..|...:.....:.:..:|.....|.:|...::...|:.|.|:..:.:|.:.....:..|  
Yeast   233 -FSFSDPFSNDSPLSQQQSQQQQQQPQQPQQHSTQKHSPQQCNQQQVNSSIPLSSQGQVIGLH-- 294

  Fly   528 KLEASRAAKAEGKVAEKKQLSDVQGDFVGTAAKPGTSLKMRSKKKIVEQ 576
                |..:..:..|....|.||:           |.|..:|...:|.|:
Yeast   295 ----SNHSHQDLSVESTIQTSDI-----------GKSFLLRDNTEINEK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM <2..>154 CDD:223796
RRM_SF 49..124 CDD:302621
RRM3_RBM28_like 230..306 CDD:240861
RRM4_RBM28_like 379..468 CDD:240862 23/101 (23%)
WHI3NP_014202.1 RRM 450..>648 CDD:223796
RRM_scw1_like 536..624 CDD:409691
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.