DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and Y14

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_564591.1 Gene:Y14 / 841576 AraportID:AT1G51510 Length:202 Species:Arabidopsis thaliana


Alignment Length:142 Identity:37/142 - (26%)
Similarity:66/142 - (46%) Gaps:20/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AESQSQPET---GVRKRRNPFNTQRLKEEK-----------ERRQKKRARLIVRNISYKSTEDSL 64
            |..:|..:|   |.|:.::....:||....           .:|..:...::|..:..::.|:.:
plant    47 ANGESAKKTKGRGFREEKDSDRQRRLSSRDFESLGSDGRPGPQRSVEGWIILVSGVHEETQEEDI 111

  Fly    65 REHFGQWGTLEDVHI-LKRGDGKLVGCAFVQYETINQATKAILNSNGKELLGRKVFVDWAL---- 124
            ...||.:|.:::::: |.|..|.:.|.|.::||...:|..||...||.|||.:.|.||||.    
plant   112 TNAFGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISAMNGAELLTQNVSVDWAFSSGP 176

  Fly   125 -GKDEYVSKNPK 135
             |.:.|..||.:
plant   177 SGGESYRRKNSR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 24/75 (32%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
Y14NP_564591.1 RRM_RBM8 89..176 CDD:409762 26/86 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.