DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and SC35

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_201225.1 Gene:SC35 / 836541 AraportID:AT5G64200 Length:303 Species:Arabidopsis thaliana


Alignment Length:200 Identity:45/200 - (22%)
Similarity:82/200 - (41%) Gaps:30/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LIVRNISYKSTEDSLREHFGQWGTLEDVHI---LKRGDGKLVGCAFVQYETINQATKAILNSNGK 111
            |:|.||::::|.|.|...|.::|.:.||.|   .:.||.:  |.|||:|:..::|.||:...:|:
plant    18 LLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSR--GFAFVRYKYKDEAHKAVERLDGR 80

  Fly   112 ELLGRKVFVDWA--------LGKDEYVSKNPKDEEPDEKKPKVEVKEENGDEKEVKEESDAEVGK 168
            .:.||::.|.:|        :.|...|...||......:.|: ..:.........:..|... .:
plant    81 VVDGREITVQFAKYGPNAEKISKGRVVEPPPKSRRSRSRSPR-RSRSPRRSRSPPRRRSPRR-SR 143

  Fly   169 EDESSGEDSDAESGEDEEDSGESED-----EENDEDHK----------ENKDELKSKLDIKNVKR 218
            .......|...|....:.....|.|     ||.|.||:          :.|..::.:.|.::...
plant   144 SPRRRSRDDYREKDYRKRSRSRSYDRRERHEEKDRDHRRRTRSRSASPDEKRRVRGRYDNESRSH 208

  Fly   219 EKQIS 223
            .:.:|
plant   209 SRSLS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 27/84 (32%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
SC35NP_201225.1 RRM_SRSF2_SRSF8 18..90 CDD:409751 25/73 (34%)
PHA03307 <204..>303 CDD:223039 0/9 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.