DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and GR-RBP3

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_200911.1 Gene:GR-RBP3 / 836224 AraportID:AT5G61030 Length:309 Species:Arabidopsis thaliana


Alignment Length:77 Identity:28/77 - (36%)
Similarity:45/77 - (58%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ARLIVRNISYKSTEDSLREHFGQWGTLEDVH-ILKRGDGKLVGCAFVQYETINQATKAILNSNGK 111
            ::|.:..::|...||||||.|.::|.:.|.. ||.|..|:..|..||.:.:...|:.||...:|:
plant    40 SKLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGR 104

  Fly   112 ELLGRKVFVDWA 123
            :|.||.|.|::|
plant   105 DLHGRVVKVNYA 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 28/76 (37%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
GR-RBP3NP_200911.1 RRM 39..120 CDD:440488 28/77 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.