DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and AT4G14300

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_193166.2 Gene:AT4G14300 / 827071 AraportID:AT4G14300 Length:411 Species:Arabidopsis thaliana


Alignment Length:222 Identity:46/222 - (20%)
Similarity:85/222 - (38%) Gaps:53/222 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 DVQEGCTVFIKNVPFDAEDADLRKACRKFGLVSYAIINRQAVSGHSKGTAFVKFKAKESADLCLQ 289
            |..:| .:|:..:.::.::..||:....:|.||.||:.|..::|..:|..||.|......|..||
plant     2 DSDQG-KLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQ 65

  Fly   290 AGTEFKLMDEVLDPHPALSREEMKSKQSQENKKDDAKDSRNLYLAREGLIMAGAKAADGVSASDM 354
              .:..:....:|...|:||||    |....:..:...||:          :|..|.:       
plant    66 --EKHSIDTREVDVKRAMSREE----QQVSGRTGNLNTSRS----------SGGDAYN------- 107

  Fly   355 AKRHELEQVKTQVLKNLNRFVSRNRLSIHNLPQNYDNEKLKQMALTYTGFRPHECRVMREHKVTP 419
                     ||:            ::.:..||....:|:.:|....|        ..:.:..:..
plant   108 ---------KTK------------KIFVGGLPPTLTDEEFRQYFEVY--------GPVTDVAIMY 143

  Fly   420 EHPQGKSKGFGFLSFDTHQRALAALRK 446
            :....:.:||||:|||:.....:.|.|
plant   144 DQATNRPRGFGFVSFDSEDAVDSVLHK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848
RRM3_Nop4p 229..312 CDD:410077 23/82 (28%)
RRM4_RBM28_like 379..468 CDD:409850 14/68 (21%)
PTZ00121 <473..>622 CDD:173412
AT4G14300NP_193166.2 RRM1_hnRNPA_hnRNPD_like 8..78 CDD:409763 18/71 (25%)
RRM2_Hrp1p 111..188 CDD:409767 14/68 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.