DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and AT3G08000

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_187457.1 Gene:AT3G08000 / 819991 AraportID:AT3G08000 Length:143 Species:Arabidopsis thaliana


Alignment Length:78 Identity:24/78 - (30%)
Similarity:41/78 - (52%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ARLIVRNISYKSTEDSLREHFGQWGTLEDVHI-LKRGDGKLVGCAFVQYETINQATKAILNSNGK 111
            ::|.:..:|:...|.||::.|..:|.:.:|.| ..:|.|:..|..||.:.....|..|....:||
plant    41 SKLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDFAEEGDALSAKDAMDGK 105

  Fly   112 ELLGRKVFVDWAL 124
            .||||.:.:.:||
plant   106 GLLGRPLRISFAL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 22/75 (29%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
AT3G08000NP_187457.1 RRM 42..124 CDD:440488 24/77 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.