DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and AT2G43370

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_850395.1 Gene:AT2G43370 / 818938 AraportID:AT2G43370 Length:333 Species:Arabidopsis thaliana


Alignment Length:246 Identity:52/246 - (21%)
Similarity:90/246 - (36%) Gaps:74/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LIVRNISYKSTEDSLREHFGQWGTLEDVHILKR-GDGKLVGCAFVQYETINQATKAILNSNGKEL 113
            |.|..:|:.:|||:|||...::|.::::.:::. ..|...|..||:|||..:..:|..:::...:
plant    66 LFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDAHHSLI 130

  Fly   114 LGRKVFVDW----------------ALG------------------------------------- 125
            .||::.||:                .||                                     
plant   131 DGREIIVDYNRQQLMPGWIPRRLGGGLGGRKESGQLRFGGRDRPFRAPLRPIPHEDLKKLGIQLP 195

  Fly   126 -KDEYVSKNPKDEEPDEKKPKVEVKEEN--------GDEKEVKEESDAEVGKEDESSG--EDSDA 179
             :..|:|:. :...|..:|..|..:||.        ..|:|.||.|.........||.  ..|..
plant   196 PEGRYMSRT-QIPSPPRRKGSVSDREEEYYREKSSVEREEEFKERSSLRSYHSHRSSAHTHSSHR 259

  Fly   180 ESGEDEEDSGESEDEENDEDHKENKDELK-----SKLDIKNVKREKQISND 225
            ...:|.|   |...||:..|.||....::     :|.::...||.|:...|
plant   260 RRSKDRE---ECSREESRSDRKERARGMEDRYGDNKGEVSGSKRSKRSEED 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 22/90 (24%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
AT2G43370NP_850395.1 RRM_snRNP35 60..150 CDD:409683 22/83 (27%)
U2AF_lg 218..>324 CDD:273727 23/93 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.