DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and PAB4

DIOPT Version :9

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_179916.1 Gene:PAB4 / 816867 AraportID:AT2G23350 Length:662 Species:Arabidopsis thaliana


Alignment Length:305 Identity:79/305 - (25%)
Similarity:132/305 - (43%) Gaps:38/305 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EKERRQKKRARLIVRNISYKSTEDSLREHFGQWGTLEDVHILKRGDGKLVGCAFVQYETINQATK 103
            :...|:.....|.|:|:.......:|.|.|...||:....:.....|:..|..|||::|.:.|..
plant   125 DSSARRSGVGNLFVKNLDKSVDNKTLHEAFSGCGTIVSCKVATDHMGQSRGYGFVQFDTEDSAKN 189

  Fly   104 AILNSNGKELLGRKVFVDWALGKDEYVSKNPKDEEPDEKKPKVEVKEENGDEKEVKEESDAEVGK 168
            ||...|||.|..:::||...|.|:|       .|...:|.....|..:|..|....:|.....|:
plant   190 AIEKLNGKVLNDKQIFVGPFLRKEE-------RESAADKMKFTNVYVKNLSEATTDDELKTTFGQ 247

  Fly   169 EDESSG----EDSDAESG-------EDEEDSGESEDEENDE--DHKE---NKDELKSKLDIKNVK 217
            ....|.    .|.|.:|.       |:.||:..:.:..|.:  |.||   .|.:.||:.:::..:
plant   248 YGSISSAVVMRDGDGKSRCFGFVNFENPEDAARAVEALNGKKFDDKEWYVGKAQKKSERELELSR 312

  Fly   218 REKQISND---VQEGCTVFIKNVPFDAEDADLRKACRKFGLVSYAIINRQAVSGHSKGTAFVKFK 279
            |.:|.|:|   ..:|..:::||:.....|..||:...:||.::...:.|.. ||.|||:.||.|.
plant   313 RYEQGSSDGGNKFDGLNLYVKNLDDTVTDEKLRELFAEFGTITSCKVMRDP-SGTSKGSGFVAFS 376

  Fly   280 AKESADLCLQAGTEFKLMDEVLDPHP-----ALSREEMKSK-QSQ 318
            |...|...|.     ::..:::...|     |..:||.::| |:|
plant   377 AASEASRVLN-----EMNGKMVGGKPLYVALAQRKEERRAKLQAQ 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM <2..>154 CDD:223796 31/114 (27%)
RRM_SF 49..124 CDD:302621 23/74 (31%)
RRM3_RBM28_like 230..306 CDD:240861 20/80 (25%)
RRM4_RBM28_like 379..468 CDD:240862
PAB4NP_179916.1 PABP-1234 47..631 CDD:130689 79/305 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.