DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and RBM23

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001339693.1 Gene:RBM23 / 55147 HGNCID:20155 Length:483 Species:Homo sapiens


Alignment Length:58 Identity:18/58 - (31%)
Similarity:27/58 - (46%) Gaps:11/58 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VKQKNVSADENSESTILGLSDARSMEGLGETDKALVQKIDKFLKTHTISFDLSEARGS 143
            |.:|:|.....||:..:.|||:...|.|  ..|.|..:::         ||.||.:||
Human  2178 VGRKSVPLTTASEAVEVTLSDSGGQEDL--PAKGLSVRLE---------FDYSEDKGS 2224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 12/37 (32%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
RBM23NP_001339693.1 SF-CC1 143..482 CDD:273721
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.