DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and rbm8a

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001013363.1 Gene:rbm8a / 503767 ZFINID:ZDB-GENE-050306-51 Length:174 Species:Danio rerio


Alignment Length:151 Identity:43/151 - (28%)
Similarity:77/151 - (50%) Gaps:11/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKMKSLKDDAAESQSQ---PETGVRKR-RNPFNT--QRLKEEKERRQKKRARLIVRNISYKSTED 62
            :.:..||:.|.:.:.:   .|.|.|.| |..::|  |...|...:|..:...|.|..:..::||:
Zfish    23 ESIHKLKEKAKKRKGRGFGSEEGARSRVREDYDTVEQDGDEPGPQRSVEGWILFVTGVHEEATEE 87

  Fly    63 SLREHFGQWGTLEDVHI-LKRGDGKLVGCAFVQYETINQATKAILNSNGKELLGRKVFVDWALGK 126
            .:.:.|.::|.::::|: |.|..|.|.|.|.|:|||..:|..|:...||:||:|:.:.|||...:
Zfish    88 DVHDKFAEFGEIKNLHLNLDRRTGYLKGYALVEYETYKEAQAAMEGLNGQELMGQPISVDWCFVR 152

  Fly   127 DEYVSK----NPKDEEPDEKK 143
            ....||    ..:...||.::
Zfish   153 GPPKSKRRGGRRRSRSPDRRR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 27/75 (36%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
rbm8aNP_001013363.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 12/46 (26%)
RRM_RBM8 67..154 CDD:409762 28/86 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..174 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.