DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and shep

DIOPT Version :9

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster


Alignment Length:252 Identity:48/252 - (19%)
Similarity:86/252 - (34%) Gaps:89/252 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 ISNDVQEG------CTVFIKNVPFDAEDADLRKACRKFGLV--SYAIINRQAVSGHSKGTAFVKF 278
            :.|..|:|      ..::|:.:.....|.||...|.::|.:  :.||:::  .:...||..||.|
  Fly   229 VQNQNQQGGEQLSKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDK--TTNKCKGYGFVDF 291

  Fly   279 KAKESADLCLQAGTEFKLMDEVLDPHPALSREEMKSKQSQENKKDDAKDSRNLYLAREGLIMAGA 343
            :....|: |...|.                  :.|..|:|..|:.: :|..|||:|         
  Fly   292 EQPAFAE-CAVKGL------------------QGKGVQAQMAKQQE-QDPTNLYIA--------- 327

  Fly   344 KAADGVSASDMAKRHELEQVKTQVLKNLNRFVSRNRLSIHNLPQNYDNEKLKQMALTYTGFRPHE 408
                                                    |||.::....|:.|...|.  :...
  Fly   328 ----------------------------------------NLPPHFKETDLEAMLSKYG--QVVS 350

  Fly   409 CRVMREHKVTPEHPQGKSKGFGFLSFDTHQRALAALRKLNNNPNIFGTQSRPIVAFS 465
            .|::|:.       |..|||.||...::.::....::..|.| .|.|.:...:|.|:
  Fly   351 TRILRDQ-------QMNSKGVGFARMESREKCEQIIQMFNGN-TIPGAKDPLLVKFA 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM <2..>154 CDD:223796
RRM_SF 49..124 CDD:302621
RRM3_RBM28_like 230..306 CDD:240861 16/77 (21%)
RRM4_RBM28_like 379..468 CDD:240862 20/87 (23%)
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 18/90 (20%)
RRM2_MSSP 322..400 CDD:240690 24/137 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.