DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and CG10466

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:158 Identity:42/158 - (26%)
Similarity:69/158 - (43%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NPF----NTQRLKEEKERRQKKR---------ARLIVRNISYKSTEDSLREHFGQWGTLEDVHIL 80
            ||.    |..:|.|.:.:...|:         |.:.|....|..||..|...|.|:|.:.:::::
  Fly     2 NPLTNMKNVLKLSEHELQHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLI 66

  Fly    81 KRG-DGKLVGCAFVQYETINQATKAILNSNGKELLGRKVFVDWALGKDEYVSKNPKD-EEPDEK- 142
            :.. .||..|..|:.||.......|:.|.||.::|.|.:.||...   :|  |.||: |:.||: 
  Fly    67 RDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVA---DY--KPPKENEKMDEET 126

  Fly   143 ----------KPKVE-VKEENGDEKEVK 159
                      ||::: :|.|..|.|..:
  Fly   127 LRLYMEGCAPKPQLQHIKTEKKDSKNYR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 22/75 (29%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/90 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.