DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and Spx

DIOPT Version :9

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster


Alignment Length:250 Identity:53/250 - (21%)
Similarity:94/250 - (37%) Gaps:93/250 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 IIN----RQAVSGHSKGTAFVKFKAKESADLCLQAGTEFKLMDEVLDPHPALSREEMKSKQSQEN 320
            ::|    :..|:...:|..||:|.::|.||..:      |:|:.:          ::..|..:.|
  Fly    39 VVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGI------KIMNMI----------KLYGKPIRVN 87

  Fly   321 KKDDAKDSRNLYLAREGLIMAGAKAADGVSASDMAKRHELEQVKTQVLKNLNRFVSRNRLSIHNL 385
            |                                 |..|:         |||:  |..| :.|.||
  Fly    88 K---------------------------------ASAHQ---------KNLD--VGAN-IFIGNL 107

  Fly   386 PQNYDNEKLKQMALTYTGFRPHECRVMREHKVTPEHPQGKSKGFGFLSFDTHQRALAALRKLNNN 450
            ....| |||.....:..|......::||:    ||  .||||.|.|::|.:.:.:.||:..:|..
  Fly   108 DVEVD-EKLLYDTFSAFGVILQTPKIMRD----PE--TGKSKSFAFINFASFEASDAAMDAMNGQ 165

  Fly   451 PNIFGTQSRPI-VAFSIEDRAVHKIKEKRTER---------SKQNNPTYQNKQQE 495
                ...:||| |:::.:       |:.:.||         :.||..|:.::..:
  Fly   166 ----YLCNRPISVSYAFK-------KDHKGERHGSAAERLLAAQNPSTHADRPHQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM <2..>154 CDD:223796
RRM_SF 49..124 CDD:302621
RRM3_RBM28_like 230..306 CDD:240861 11/49 (22%)
RRM4_RBM28_like 379..468 CDD:240862 26/89 (29%)
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 12/64 (19%)
RRM2_SF3B4 99..181 CDD:240781 27/100 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.