DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and TRA2A

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens


Alignment Length:155 Identity:40/155 - (25%)
Similarity:71/155 - (45%) Gaps:38/155 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KDDAAESQSQPETGVRKRRNP---FNTQRLKEEKERR-----------QKKRAR----------- 49
            |...:.|:|:.::..|.||:.   :...|......||           :::|:|           
Human    44 KHSESHSRSRSKSRSRSRRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRH 108

  Fly    50 ------------LIVRNISYKSTEDSLREHFGQWGTLEDVHIL-KRGDGKLVGCAFVQYETINQA 101
                        |.|..:|..:||..|||.|.::|.|..|::: .:..|:..|.|||.:|.|:.:
Human   109 TGSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDS 173

  Fly   102 TKAILNSNGKELLGRKVFVDWALGK 126
            .:|:..:||.||.||::.||:::.|
Human   174 KEAMERANGMELDGRRIRVDYSITK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 29/98 (30%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 11/73 (15%)
RRM_TRA2 118..197 CDD:409798 28/78 (36%)
Linker 198..225 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.