DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and bru2

DIOPT Version :9

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001036356.1 Gene:bru2 / 250811 FlyBaseID:FBgn0262475 Length:893 Species:Drosophila melanogaster


Alignment Length:292 Identity:58/292 - (19%)
Similarity:108/292 - (36%) Gaps:99/292 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DELKSKLDIKNVKREKQISNDVQEGCTVFIKNVPFDAEDADLRKACRKFGLVSYAIINRQAVSGH 269
            |.:|.:.|..|:|              :|:..:|...::..||:...:||.|....:.|..|:..
  Fly   284 DSIKDQPDADNIK--------------MFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSI 334

  Fly   270 SKGTAFVKFKAKESADLCLQAGTEFKLMDEVLDPHPALSREEMKSKQSQENKKDDAKDSRNLYLA 334
            |:|..||.:..:::|                           ::::.:..|              
  Fly   335 SRGCCFVTYYTRKAA---------------------------LRAQDALHN-------------- 358

  Fly   335 REGLIMAGAKAADGVSASDMAKRHELEQVKTQVLKNLNRFVSRNRLSIHNLPQNYDNEKLKQMAL 399
                    .|..||:        |...|:|....:|.|    ..:|.:..|.:.|....::|:  
  Fly   359 --------IKTLDGM--------HHPIQMKPADSENRN----ERKLFVGMLNKKYTEADVRQL-- 401

  Fly   400 TYTGFRP-HECRVMREHKVTPEHPQGKSKGFGFLSFDTHQRALAALRKLNNNPNIFGTQSRPIVA 463
             :||... .||.|:|:.       .|:|||..|::|.|.|.|:.|::.|:.:..:.|..:..:|.
  Fly   402 -FTGHGTIEECTVLRDQ-------AGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVK 458

  Fly   464 FSIEDRAVHKIKEKRTERSKQ-------NNPT 488
            |:...      |||..::.:|       |.|:
  Fly   459 FADTQ------KEKDQKKMQQIHAFCGINTPS 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM <2..>154 CDD:223796
RRM_SF 49..124 CDD:302621
RRM3_RBM28_like 230..306 CDD:240861 14/75 (19%)
RRM4_RBM28_like 379..468 CDD:240862 24/89 (27%)
bru2NP_001036356.1 RRM1_CELF1_2_Bruno 294..375 CDD:241075 23/151 (15%)
RRM2_Bruno_like 381..461 CDD:241080 24/89 (27%)
RRM_SF 801..892 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.