DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and EEED8.4

DIOPT Version :9

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_495022.2 Gene:EEED8.4 / 173921 WormBaseID:WBGene00017135 Length:191 Species:Caenorhabditis elegans


Alignment Length:83 Identity:18/83 - (21%)
Similarity:38/83 - (45%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EKERRQKKRARLIVRNISYKSTEDSLREHFGQWGTLEDVHILK-RGDGKLVGCAFVQYETINQAT 102
            |:|::......:.:.|:.:.||.:.:.|||...|.:....|.| :...|....|:::::..:...
 Worm    46 EEEQKAIDAKSVFIGNVDFNSTIEEIEEHFKGCGQIVKTTIPKDKFTKKQKNFAYIEFDDSSSIE 110

  Fly   103 KAILNSNGKELLGRKVFV 120
            .|:: .||.....|.:.|
 Worm   111 NALV-MNGSLFRSRPIVV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM <2..>154 CDD:223796 18/83 (22%)
RRM_SF 49..124 CDD:302621 16/73 (22%)
RRM3_RBM28_like 230..306 CDD:240861
RRM4_RBM28_like 379..468 CDD:240862
EEED8.4NP_495022.2 RRM <2..>127 CDD:223796 17/81 (21%)
RRM_II_PABPs 56..128 CDD:240752 16/73 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.