DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and Rsf1

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:XP_061509636.1 Gene:Rsf1 / 1280099 VectorBaseID:AGAMI1_014631 Length:224 Species:Anopheles gambiae


Alignment Length:90 Identity:26/90 - (28%)
Similarity:47/90 - (52%) Gaps:9/90 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KRARLIVRNISYKSTEDSLREHFGQWGTLEDVHILKRGDGKLVGCAFVQYETINQATKAILNSNG 110
            |..|:.|.|::.|..::.|...|.::|.|..|.:.....    |.||:::|...:|..|..|.||
Mosquito     5 KGTRVYVGNLTDKVKKEDLEGEFTKYGKLNSVWVAFNPP----GFAFIEFENKEEAETACDNLNG 65

  Fly   111 KELLGRKVFVDWALGKDEYVSKNPK 135
            :::||.|:.|:.:.|:     :||:
Mosquito    66 QDILGSKLRVEISKGR-----RNPR 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 22/74 (30%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
Rsf1XP_061509636.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.