DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and Tra2a

DIOPT Version :10

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001393046.1 Gene:Tra2a / 101214 MGIID:1933972 Length:311 Species:Mus musculus


Alignment Length:155 Identity:38/155 - (24%)
Similarity:67/155 - (43%) Gaps:38/155 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KDDAAESQSQPETGVRKRRNPFNTQRLKEEKERRQKKRAR------------------------- 49
            |...:.|:|:.::..|.||:.............|::.|:|                         
Mouse    71 KHSESHSRSRSKSRSRSRRHSHRRYTRSRSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTG 135

  Fly    50 ------------LIVRNISYKSTEDSLREHFGQWGTLEDVHIL-KRGDGKLVGCAFVQYETINQA 101
                        |.|..:|..:||..|||.|.::|.|..|::: .:..|:..|.|||.:|.|:.:
Mouse   136 SRVCANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDS 200

  Fly   102 TKAILNSNGKELLGRKVFVDWALGK 126
            .:|:..:||.||.||::.||:::.|
Mouse   201 KEAMERANGMELDGRRIRVDYSITK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM2_RBM28_like 49..124 CDD:409848 29/112 (26%)
RRM3_Nop4p 229..312 CDD:410077
RRM4_RBM28_like 379..468 CDD:409850
PTZ00121 <473..>622 CDD:173412
Tra2aNP_001393046.1 RRM_TRA2 145..224 CDD:409798 28/78 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.