DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4806 and LOC100490872

DIOPT Version :9

Sequence 1:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster
Sequence 2:XP_002932728.2 Gene:LOC100490872 / 100490872 -ID:- Length:449 Species:Xenopus tropicalis


Alignment Length:175 Identity:42/175 - (24%)
Similarity:71/175 - (40%) Gaps:47/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KSLKDDAAESQSQPETGVRKRRNPFNTQ--------------------RLKEEKERRQKKR---- 47
            |.:.:|..:   |.|.|:.    |||.|                    ::||:::....|:    
 Frog    71 KIINNDCGQ---QTEFGLL----PFNKQKDAIRAVDKMKGMDIYLAQAKIKEKRQTEFSKKPEPL 128

  Fly    48 -------ARLIVRNISYKSTEDSLREHFGQWGTLEDVHILKRGDGKLVGCAFVQYETINQATKAI 105
                   ..|.|:|:||:..:..|.:.|..:|.:....:::.| |:..|..||.:.|..:|.||:
 Frog   129 HKPRYNSVNLYVKNLSYEIDDYRLNKEFAPFGIITSAKVMREG-GRSKGFGFVCFSTPAEARKAL 192

  Fly   106 LNSNGKELLGRKVFVDWALGKDE--------YVSKNPKDEEPDEK 142
            ...|||.|..:.::|.||..|.|        |..:..|...|:.|
 Frog   193 SGMNGKILASKPLYVAWAQRKQERQVSLAQQYTQRMEKAWIPNTK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4806NP_611955.2 RRM <2..>154 CDD:223796 42/175 (24%)
RRM_SF 49..124 CDD:302621 23/74 (31%)
RRM3_RBM28_like 230..306 CDD:240861
RRM4_RBM28_like 379..468 CDD:240862
LOC100490872XP_002932728.2 PABP-1234 <7..431 CDD:130689 42/175 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1181291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.