DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pof and Celf3

DIOPT Version :9

Sequence 1:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001276542.1 Gene:Celf3 / 78784 MGIID:1926034 Length:494 Species:Mus musculus


Alignment Length:217 Identity:41/217 - (18%)
Similarity:75/217 - (34%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 TNKPGQTPASEVLLVR----FPDPEITAPMLAGLSKDIRDVVLPISVAPRYCLVHLKAGADVEAT 182
            |...|| ||.:.|...    :||..::|...||        .:||.......||.|.|.....|.
Mouse   287 TQPTGQ-PAPDALYPNGVHPYPDEALSAERSAG--------GVPIMSQAHSWLVMLSAAQSPAAP 342

  Fly   183 ICDINRVRFGTGHLRA----------------------------------ELKPFSDEEQAEFID 213
            :..:.:...|..|..|                                  :.:....::|.|..|
Mouse   343 VDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPD 407

  Fly   214 PCSLYVGNIPFNMTTSAIKAY---FANAMRVDIGVLKREKRAR-YAFVRYASPDQTMEAFKELVD 274
            .|::::.::|...|.|.|...   |.:.:...:.|.:...::: :.||.:.:|.....|.:.:..
Mouse   408 GCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNG 472

  Fly   275 SPLNSRTLTVRYRRLRKRAGMP 296
            ..:..:.|.|:.:| .|.|..|
Mouse   473 FQIGMKRLKVQLKR-PKDANRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PofNP_001246498.1 RRM <201..>292 CDD:223796 17/94 (18%)
RRM_SF 217..285 CDD:240668 11/71 (15%)
Celf3NP_001276542.1 RRM1_CELF3_4_5_6 2..88 CDD:410041
RRM2_CELF3_4_5_6 94..174 CDD:410043
PRK12323 <214..379 CDD:237057 21/100 (21%)
RRM3_CELF3_4_5_6 405..483 CDD:241083 13/77 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836397
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.