DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pof and zgc:165603

DIOPT Version :9

Sequence 1:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001092221.1 Gene:zgc:165603 / 571425 ZFINID:ZDB-GENE-070620-21 Length:155 Species:Danio rerio


Alignment Length:194 Identity:35/194 - (18%)
Similarity:65/194 - (33%) Gaps:77/194 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 AKLSRRELAKMRREHTLRALALERE-LTNKPGQTP---ASEVLL---------VRFPDPEITAPM 147
            |:.::.|..:.:::|.......... |...||..|   |:.:||         :.:|.|      
Zfish     2 ARFTQTEARRQQQQHPQHPQPAHASLLLTGPGAVPSQAAAPLLLIPHQPQYAHISYPKP------ 60

  Fly   148 LAGLSKDIRDVVLPISVAPRYCLVHLKAGADVEATICDINRVRFGTGHLRAELKPFSDEEQAEFI 212
            :.|..        |||:.|                         .:|.::.:             
Zfish    61 MNGSE--------PISIHP-------------------------DSGTMKDQ------------- 79

  Fly   213 DPCSLYVGNIPFNMTTSAIKAYFANAMRV-DIGVLKREKRARY-------AFVRYASPDQTMEA 268
            |...|::|.||.|:....:|..|....:: ::.|||    .||       ||:.|.:.:..::|
Zfish    80 DAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLK----DRYTGMHKGCAFLTYCARESAIKA 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PofNP_001246498.1 RRM <201..>292 CDD:223796 17/76 (22%)
RRM_SF 217..285 CDD:240668 16/60 (27%)
zgc:165603NP_001092221.1 RRM <56..>147 CDD:223796 25/140 (18%)
RRM1_CELF3_4_5_6 77..153 CDD:241076 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.