DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pof and Celf3

DIOPT Version :9

Sequence 1:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_038958836.1 Gene:Celf3 / 499669 RGDID:1563168 Length:526 Species:Rattus norvegicus


Alignment Length:224 Identity:41/224 - (18%)
Similarity:75/224 - (33%) Gaps:59/224 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 TNKPGQTPASEVLLVR----FPDPEITAPMLAGLSKDIRDVVLPISVAPRYCLVHLKAGADVEAT 182
            |...|| ||.:.|...    :||..::|...||.:        ||.......||.|.|.....|.
  Rat   312 TQPTGQ-PAPDALYPNGVHPYPDEALSAERSAGEA--------PIMPQTHSWLVMLSAAQSPAAP 367

  Fly   183 ICDINRVRFGTGHLRA-----------------------------------------ELKPFSDE 206
            :..:.:...|..|..|                                         :.:....:
  Rat   368 VDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQQQQQQ 432

  Fly   207 EQAEFIDPCSLYVGNIPFNMTTSAIKAY---FANAMRVDIGVLKREKRAR-YAFVRYASPDQTME 267
            :|.|..|.|::::.::|...|.|.|...   |.:.:...:.|.:...::: :.||.:.:|.....
  Rat   433 QQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQA 497

  Fly   268 AFKELVDSPLNSRTLTVRYRRLRKRAGMP 296
            |.:.:....:..:.|.|:.:| .|.|..|
  Rat   498 AIQAMNGFQIGMKRLKVQLKR-PKDANRP 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PofNP_001246498.1 RRM <201..>292 CDD:223796 17/94 (18%)
RRM_SF 217..285 CDD:240668 11/71 (15%)
Celf3XP_038958836.1 RRM1_CELF3_4_5_6 2..88 CDD:410041
RRM2_CELF3_4_5_6 94..199 CDD:410043
minC <242..>376 CDD:178806 18/72 (25%)
RRM3_CELF3_4_5_6 437..515 CDD:241083 13/77 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.