DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pof and Celf5

DIOPT Version :9

Sequence 1:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_038934951.1 Gene:Celf5 / 314647 RGDID:1565016 Length:446 Species:Rattus norvegicus


Alignment Length:307 Identity:62/307 - (20%)
Similarity:104/307 - (33%) Gaps:90/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 IDPCSLYVGNIPFNMTTSAIKAYFANAMRV-DIGVLKREKRARY---AFVRYASPDQTMEAFKEL 272
            :|...|:||.||.::....:|..|....|: ::.|||......:   ||:.|.:.|..::|...|
  Rat     4 LDAIKLFVGQIPRHLHEQDLKPLFEQFGRIYELTVLKDPHTGVHKGCAFLTYCARDSAIKAQTAL 68

  Fly   273 VDS---PLNSRTLTVRYRRLRKRAG---------MPMVQCATSFQALQSPNGDDDNTDCKVISPP 325
            .:.   |..:|.:.|:......|.|         :...|.......|..|.|..|  :|.|:..|
  Rat    69 HEQKTLPGMARPIQVKPADSENRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVID--ECTVLRGP 131

  Fly   326 PLESIIISDSDNCS---DSS------------GNGKEDGKRKKKI-----NEQEREIEKLKRQMA 370
            .      ..|..|:   .||            |:....|.....:     .::||.:.::::.:.
  Rat   132 D------GSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVG 190

  Fly   371 E--------------YGAIIKSLQFRQNSLEDTFIPDLTPKV--------------------EPS 401
            :              |.|..::|..:|.::..|....|:|.|                    .|.
  Rat   191 QLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFPPCHIQQIGTVSLNGLPATPI 255

  Fly   402 VNPTGC----LLGSNAV-HLMRDIKKECDYLGIPD--PVPATKPTTQ 441
            ...:|.    |||:.|| .||..|..     |.|.  |.|.:.|..:
  Rat   256 APASGLHSPPLLGTAAVPGLMTSIPS-----GFPGVLPFPGSHPALE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PofNP_001246498.1 RRM <201..>292 CDD:223796 21/86 (24%)
RRM_SF 217..285 CDD:240668 19/74 (26%)
Celf5XP_038934951.1 RRM1_CELF3_4_5_6 2..88 CDD:410041 21/83 (25%)
PABP-1234 <9..358 CDD:130689 61/302 (20%)
RRM2_CELF3_4_5_6 95..175 CDD:410043 14/87 (16%)
RRM3_CELF3_4_5_6 357..435 CDD:241083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.