DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pof and Celf4

DIOPT Version :9

Sequence 1:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_038952808.1 Gene:Celf4 / 307540 RGDID:1307630 Length:583 Species:Rattus norvegicus


Alignment Length:252 Identity:45/252 - (17%)
Similarity:81/252 - (32%) Gaps:90/252 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 PFSDEEQAEFIDPCSLYVGNIPFNMTTSAIKAYFANAMRV-DIGVLKREKRARY---AFVRYASP 262
            |..|.      |...|::|.||.|:....:|..|....:: ::.|||......:   ||:.|...
  Rat    47 PMKDH------DAIKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCER 105

  Fly   263 DQTMEAFKELVDS---PLNSRTLTVRYRRLRKRAG-----MPMVQCATSFQALQSPNGDDDNT-- 317
            :..::|...|.:.   |..:|.:.|:......|.|     .|..|....|..:.:....:|:.  
  Rat   106 ESALKAQSALHEQKTLPGMNRPIQVKPADSESRGGSSCLRQPPSQDRKLFVGMLNKQQSEDDVRR 170

  Fly   318 ---------DCKVISPPPLESIIISDSDNCSDSSGNGK--------EDGKRKKKIN--------- 356
                     :|.::..|                .||.|        ...:.:..||         
  Rat   171 LFEAFGNIEECTILRGP----------------DGNSKGCAFVKYSSHAEAQAAINALHGSQTMP 219

  Fly   357 -------------EQEREIEKLKRQMA--------------EYGAIIKSLQFRQNSL 386
                         ::||.:.:: :|||              .|||..::|..:|.:|
  Rat   220 GASSSLVVKFADTDKERTMRRM-QQMAGQMGMFNPMAIPFGAYGAYAQALMQQQAAL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PofNP_001246498.1 RRM <201..>292 CDD:223796 21/96 (22%)
RRM_SF 217..285 CDD:240668 17/74 (23%)
Celf4XP_038952808.1 RRM1_CELF3_4_5_6 49..135 CDD:410041 20/91 (22%)
PABP-1234 <56..378 CDD:130689 42/237 (18%)
RRM2_CELF3_4_5_6 151..231 CDD:410043 9/95 (9%)
RRM_SF 417..>465 CDD:418427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.